Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4380
Gene name
LocationContig_401:5409..6279
Strand+
Gene length (bp)870
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 7.4E-47 27 207
PF12465 Pr_beta_C Proteasome beta subunits C terminal 2.6E-12 221 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 3 270 1.0E-117
sp|P25043|PSB2_YEAST Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 1 253 5.0E-115
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 3 245 5.0E-106
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 3 245 5.0E-106
sp|A1XQU1|PSB7_PIG Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 3 245 8.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 3 270 1.0E-117
sp|P25043|PSB2_YEAST Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 1 253 5.0E-115
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 3 245 5.0E-106
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 3 245 5.0E-106
sp|A1XQU1|PSB7_PIG Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 3 245 8.0E-106
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 3 245 9.0E-106
sp|Q2TBP0|PSB7_BOVIN Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 3 245 2.0E-105
sp|Q7DLS1|PSB7B_ARATH Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2 3 264 1.0E-97
sp|O23710|PSB7A_ARATH Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2 3 253 9.0E-97
sp|Q54QR2|PSB7_DICDI Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1 3 245 2.0E-93
sp|P40306|PSB10_HUMAN Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1 3 245 2.0E-84
sp|O35955|PSB10_MOUSE Proteasome subunit beta type-10 OS=Mus musculus GN=Psmb10 PE=1 SV=1 3 245 1.0E-81
sp|Q3T0T1|PSB10_BOVIN Proteasome subunit beta type-10 OS=Bos taurus GN=PSMB10 PE=1 SV=1 3 270 1.0E-80
sp|Q4KM35|PSB10_RAT Proteasome subunit beta type-10 OS=Rattus norvegicus GN=Psmb10 PE=2 SV=1 3 245 7.0E-80
sp|Q8SQN7|PSB2_ENCCU Probable proteasome subunit beta type-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP1 PE=1 SV=1 26 218 1.0E-53
sp|A2SS78|PSB_METLZ Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 24 211 9.0E-33
sp|Q9DD33|PSB9_SALSA Proteasome subunit beta type-9 OS=Salmo salar GN=psmb9-a PE=2 SV=1 22 199 2.0E-27
sp|Q3MHN0|PSB6_BOVIN Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1 27 219 2.0E-27
sp|Q9PT26|PSB9_ONCMY Proteasome subunit beta type-9 OS=Oncorhynchus mykiss GN=psmb9 PE=2 SV=1 22 199 4.0E-27
sp|A7I841|PSB_METB6 Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 24 211 4.0E-26
sp|P28072|PSB6_HUMAN Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 27 219 5.0E-26
sp|B1L6S7|PSB1_KORCO Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 29 225 6.0E-26
sp|Q55GJ6|PSB6_DICDI Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1 22 209 9.0E-26
sp|B8GG66|PSB_METPE Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 26 210 9.0E-26
sp|A3CUS9|PSB_METMJ Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 24 211 1.0E-25
sp|P28073|PSB6_RAT Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 27 219 2.0E-25
sp|O43063|PSB1_SCHPO Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 29 210 2.0E-25
sp|Q60692|PSB6_MOUSE Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 27 219 9.0E-25
sp|D2RGT4|PSB_ARCPA Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 29 210 3.0E-24
sp|Q2FQL8|PSB_METHJ Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 26 210 6.0E-24
sp|A1RX71|PSB2_THEPD Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 29 212 6.0E-24
sp|A1RWY6|PSB1_THEPD Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 29 216 7.0E-24
sp|Q9P996|PSB_ARCFU Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 29 211 3.0E-23
sp|Q8UW64|PSB9_ORYLA Proteasome subunit beta type-9 OS=Oryzias latipes GN=psmb9 PE=3 SV=1 22 212 4.0E-23
sp|Q8LD27|PSB6_ARATH Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 27 224 5.0E-23
sp|Q74MP5|PSB_NANEQ Proteasome subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=psmB PE=3 SV=1 30 210 7.0E-23
sp|D4GYZ1|PSB_HALVD Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 5 217 1.0E-22
sp|Q9YER0|PSB2_AERPE Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 24 207 1.0E-22
sp|D3S8M7|PSB_METSF Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 29 217 1.0E-22
sp|Q3SZC2|PSB9_BOVIN Proteasome subunit beta type-9 OS=Bos taurus GN=PSMB9 PE=1 SV=1 22 208 4.0E-22
sp|P38624|PSB1_YEAST Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 27 208 4.0E-22
sp|P28065|PSB9_HUMAN Proteasome subunit beta type-9 OS=Homo sapiens GN=PSMB9 PE=1 SV=2 22 208 5.0E-22
sp|A9A2U7|PSB2_NITMS Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 29 215 5.0E-22
sp|D3RX66|PSB_FERPA Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 29 229 6.0E-22
sp|A4YIE0|PSB1_METS5 Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 29 226 6.0E-22
sp|A7KII6|PB6LB_SALSA Proteasome subunit beta type-6-B like protein OS=Salmo salar GN=psmb6l-b PE=3 SV=1 24 229 6.0E-22
sp|Q2NI68|PSB_METST Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 29 210 7.0E-22
sp|A7KE01|PB6LA_SALSA Proteasome subunit beta type-6-A like protein OS=Salmo salar GN=psmb6l-a PE=3 SV=1 24 229 8.0E-22
sp|C9REN7|PSB_METVM Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 26 217 1.0E-21
sp|A2BN27|PSB2_HYPBU Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 29 210 1.0E-21
sp|Q975D1|PSB2_SULTO Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 28 209 1.0E-21
sp|O50110|PSB2_PYRHO Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 29 210 1.0E-21
sp|B9LTS6|PSB_HALLT Proteasome subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=psmB PE=3 SV=1 5 216 2.0E-21
sp|Q9V0N9|PSB2_PYRAB Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 29 210 2.0E-21
sp|P93395|PSB6_TOBAC Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1 22 213 2.0E-21
sp|C7P6N4|PSB_METFA Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 29 217 4.0E-21
sp|Q58634|PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 29 217 4.0E-21
sp|A8AB58|PSB2_IGNH4 Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 29 218 6.0E-21
sp|O24361|PSB5_SPIOL Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1 2 204 8.0E-21
sp|Q8U125|PSB2_PYRFU Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 29 210 1.0E-20
sp|O23717|PSB5A_ARATH Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1 1 213 1.0E-20
sp|A6USJ3|PSB_METVS Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 29 214 2.0E-20
sp|Q9P992|PSB_METTE Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 29 210 2.0E-20
sp|A3DN21|PSB1_STAMF Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 31 225 3.0E-20
sp|Q18GX3|PSB_HALWD Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 26 210 3.0E-20
sp|A9A4A1|PSB1_NITMS Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 29 220 6.0E-20
sp|Q6LZD4|PSB_METMP Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 29 214 1.0E-19
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 22 230 1.0E-19
sp|A6UT20|PSB_META3 Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 29 209 1.0E-19
sp|Q9LIP2|PSB5B_ARATH Proteasome subunit beta type-5-B OS=Arabidopsis thaliana GN=PBE2 PE=1 SV=1 2 204 1.0E-19
sp|A2BN24|PSB1_HYPBU Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 28 225 1.0E-19
sp|A0B5B1|PSB_METTP Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 29 211 2.0E-19
sp|Q8TJB5|PSB_METAC Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 29 210 3.0E-19
sp|A4WH05|PSB1_PYRAR Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 30 210 3.0E-19
sp|Q8ZYF2|PSB1_PYRAE Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 30 211 3.0E-19
sp|A3DN27|PSB2_STAMF Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 30 219 3.0E-19
sp|Q980L4|PSB1_SULSO Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 31 210 3.0E-19
sp|D0KRX1|PSB1_SULS9 Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 31 210 3.0E-19
sp|C3N7K2|PSB2_SULIY Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 31 210 3.0E-19
sp|C3MY41|PSB2_SULIM Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 31 210 3.0E-19
sp|C3MRE5|PSB2_SULIL Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 31 210 3.0E-19
sp|C4KIR0|PSB2_SULIK Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 31 210 3.0E-19
sp|D2PDG6|PSB2_SULID Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 31 210 3.0E-19
sp|C3MZI0|PSB2_SULIA Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 31 210 3.0E-19
sp|C3NFX2|PSB1_SULIN Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 31 210 3.0E-19
sp|C3NE98|PSB1_SULIY Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 29 207 4.0E-19
sp|C3MVD5|PSB1_SULIM Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 29 207 4.0E-19
sp|C3MQ16|PSB1_SULIL Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 29 207 4.0E-19
sp|C4KHB0|PSB1_SULIK Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 29 207 4.0E-19
sp|D2PK63|PSB1_SULID Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 29 207 4.0E-19
sp|C3N5N4|PSB1_SULIA Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 29 207 4.0E-19
sp|Q46G14|PSB_METBF Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 29 210 4.0E-19
sp|A4FYA5|PSB_METM5 Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 29 214 4.0E-19
sp|P28075|PSB5_RAT Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 29 210 4.0E-19
sp|Q9UXF3|PSB2_SULSO Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 29 207 4.0E-19
sp|Q8ZST5|PSB2_PYRAE Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 22 209 4.0E-19
sp|Q9YES4|PSB1_AERPE Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 29 207 4.0E-19
sp|D0KTH0|PSB2_SULS9 Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 29 207 4.0E-19
sp|A4WMZ0|PSB2_PYRAR Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 22 209 5.0E-19
sp|A0RXV1|PSB2_CENSY Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 29 215 5.0E-19
sp|C3NHF1|PSB2_SULIN Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 29 207 8.0E-19
sp|A3MXQ6|PSB2_PYRCJ Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 24 209 8.0E-19
sp|A1RTI7|PSB2_PYRIL Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 30 210 1.0E-18
sp|A6VK02|PSB_METM7 Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 29 210 1.0E-18
sp|A9A788|PSB_METM6 Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 29 210 1.0E-18
sp|A3MS44|PSB1_PYRCJ Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 30 209 2.0E-18
sp|Q8SR11|PSB1_ENCCU Probable proteasome subunit beta type-1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE3 PE=1 SV=1 28 224 2.0E-18
sp|C5A7L1|PSB1_THEGJ Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 29 210 2.0E-18
sp|B8D683|PSB2_DESK1 Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 30 207 3.0E-18
sp|P30656|PSB5_YEAST Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 29 210 4.0E-18
sp|B1YA36|PSB1_PYRNV Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 30 211 4.0E-18
sp|P30655|PSB5_SCHPO Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pts1 PE=3 SV=3 9 218 5.0E-18
sp|P28077|PSB9_RAT Proteasome subunit beta type-9 OS=Rattus norvegicus GN=Psmb9 PE=1 SV=2 28 210 6.0E-18
sp|Q8PZ04|PSB_METMA Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 29 210 6.0E-18
sp|Q12YV7|PSB_METBU Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 29 211 6.0E-18
sp|D1Z199|PSB_METPS Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 29 219 6.0E-18
sp|A1RSJ8|PSB1_PYRIL Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 24 207 9.0E-18
sp|Q32KL2|PSB5_BOVIN Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 29 204 1.0E-17
sp|B8D673|PSB1_DESK1 Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 31 209 2.0E-17
sp|Q0W2D6|PSB_METAR Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 29 211 2.0E-17
sp|B1YDJ0|PSB2_PYRNV Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 28 207 2.0E-17
sp|D3E0A3|PSB_METRM Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 26 210 2.0E-17
sp|Q5R8S2|PSB5_PONAB Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 14 204 2.0E-17
sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 14 204 2.0E-17
sp|P28061|PSB_THEAC Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 22 210 2.0E-17
sp|Q97AZ7|PSB_THEVO Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 22 210 3.0E-17
sp|O55234|PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 29 210 3.0E-17
sp|O35523|PSB9_MUSPL Proteasome subunit beta type-9 OS=Mus platythrix GN=Psmb9 PE=1 SV=1 28 208 3.0E-17
sp|Q54BC8|PSB5_DICDI Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 29 210 3.0E-17
sp|Q5JDJ9|PSB1_THEKO Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 29 210 4.0E-17
sp|Q4JAA8|PSB2_SULAC Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 29 209 4.0E-17
sp|Q5W416|PSB8_CANLF Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 29 223 4.0E-17
sp|O35522|PSB9_MUSMB Proteasome subunit beta type-9 OS=Mus musculus bactrianus GN=Psmb9 PE=1 SV=1 28 208 4.0E-17
sp|O35521|PSB9_MUSTR Proteasome subunit beta type-9 OS=Mus terricolor GN=Psmb9 PE=1 SV=1 28 208 5.0E-17
sp|P28076|PSB9_MOUSE Proteasome subunit beta type-9 OS=Mus musculus GN=Psmb9 PE=1 SV=1 28 208 6.0E-17
sp|O35524|PSB9_MUSSI Proteasome subunit beta type-9 OS=Mus spicilegus GN=Psmb9 PE=1 SV=1 28 208 6.0E-17
sp|B1L6X8|PSB2_KORCO Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 31 214 7.0E-17
sp|B5IEE5|PSB_ACIB4 Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 40 229 8.0E-17
sp|B6YSW2|PSB1_THEON Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 29 210 2.0E-16
sp|Q4JAY3|PSB1_SULAC Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 31 220 2.0E-16
sp|P34065|PSB5_CHICK Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 29 204 3.0E-16
sp|P28062|PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens GN=PSMB8 PE=1 SV=3 29 223 8.0E-16
sp|Q975U8|PSB1_SULTO Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 31 213 1.0E-15
sp|P28064|PSB8_RAT Proteasome subunit beta type-8 OS=Rattus norvegicus GN=Psmb8 PE=1 SV=3 29 210 1.0E-15
sp|D5EAS6|PSB_METMS Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 29 210 1.0E-15
sp|Q9HR36|PSB_HALSA Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmB PE=3 SV=2 28 213 2.0E-15
sp|B0R4C8|PSB_HALS3 Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmB PE=3 SV=1 28 213 2.0E-15
sp|A8M8R5|PSB2_CALMQ Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 28 208 3.0E-15
sp|Q6L181|PSB_PICTO Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 24 229 4.0E-15
sp|Q8TYB7|PSA_METKA Proteasome subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmA PE=3 SV=1 24 210 6.0E-15
sp|C6A2V9|PSB1_THESM Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 29 210 6.0E-15
sp|A5UM14|PSB_METS3 Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 29 228 1.0E-14
sp|Q3T112|PSB8_BOVIN Proteasome subunit beta type-8 OS=Bos taurus GN=PSMB8 PE=1 SV=2 29 223 2.0E-14
sp|Q5V1D5|PSB2_HALMA Proteasome subunit beta 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB2 PE=3 SV=1 28 210 3.0E-14
sp|P28063|PSB8_MOUSE Proteasome subunit beta type-8 OS=Mus musculus GN=Psmb8 PE=1 SV=2 29 204 4.0E-14
sp|O27270|PSB_METTH Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 26 211 5.0E-14
sp|Q3IPX1|PSB_NATPD Proteasome subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmB PE=3 SV=1 40 214 1.0E-13
sp|A8MBW0|PSB1_CALMQ Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 40 210 1.0E-13
sp|C7NQ99|PSB_HALUD Proteasome subunit beta OS=Halorhabdus utahensis (strain DSM 12940 / JCM 11049 / AX-2) GN=psmB PE=3 SV=1 40 210 2.0E-13
sp|A0RU86|PSB1_CENSY Proteasome subunit beta 1 OS=Cenarchaeum symbiosum (strain A) GN=psmB1 PE=3 SV=1 29 204 2.0E-13
sp|C6A459|PSA_THESM Proteasome subunit alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmA PE=3 SV=1 24 211 3.0E-13
sp|O57983|PSB1_PYRHO Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 28 210 7.0E-13
sp|O59219|PSA_PYRHO Proteasome subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmA PE=3 SV=1 24 208 7.0E-13
sp|C6A3R1|PSB2_THESM Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 28 210 8.0E-13
sp|Q8U4C9|PSB1_PYRFU Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 28 210 1.0E-12
sp|Q8U0L6|PSA_PYRFU Proteasome subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmA PE=3 SV=1 24 220 1.0E-12
sp|A8AA46|PSB1_IGNH4 Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 29 207 2.0E-12
sp|C5A2D5|PSB2_THEGJ Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 24 210 2.0E-12
sp|D2RUI0|PSB2_HALTV Proteasome subunit beta 2 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB2 PE=3 SV=1 38 214 3.0E-12
sp|Q0RLT7|PSB_FRAAA Proteasome subunit beta OS=Frankia alni (strain ACN14a) GN=prcB PE=3 SV=2 6 199 4.0E-12
sp|Q9V122|PSA_PYRAB Proteasome subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmA PE=3 SV=1 24 208 4.0E-12
sp|Q60177|PSA_METJA Proteasome subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmA PE=1 SV=1 24 208 5.0E-12
sp|Q5JHL8|PSB2_THEKO Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 28 210 8.0E-12
sp|D3SSQ6|PSB_NATMM Proteasome subunit beta OS=Natrialba magadii (strain ATCC 43099 / DSM 3394 / NCIMB 2190 / MS3) GN=psmB PE=3 SV=1 40 214 8.0E-12
sp|Q9V247|PSB1_PYRAB Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 28 210 1.0E-11
sp|D2RQX3|PSB1_HALTV Proteasome subunit beta 1 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB1 PE=3 SV=1 40 214 2.0E-11
sp|O24733|PSA_THEK1 Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 24 184 7.0E-11
sp|Q5JIU9|PSA_THEKO Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 24 184 7.0E-11
sp|O26782|PSA_METTH Proteasome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmA PE=3 SV=1 24 208 7.0E-11
sp|Q2J9Q3|PSB_FRASC Proteasome subunit beta OS=Frankia sp. (strain CcI3) GN=prcB PE=3 SV=2 6 199 1.0E-10
sp|A5UJS2|PSA_METS3 Proteasome subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmA PE=3 SV=1 24 207 1.0E-10
sp|Q9LSU1|PSA5_ORYSJ Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 24 208 2.0E-10
sp|O73817|PSB3_ONCMY Proteasome subunit beta type-3 OS=Oncorhynchus mykiss GN=psmb3 PE=2 SV=1 41 213 2.0E-10
sp|A8LH54|PSB_FRASN Proteasome subunit beta OS=Frankia sp. (strain EAN1pec) GN=prcB PE=3 SV=1 17 199 3.0E-10
sp|A4YJ04|PSB2_METS5 Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 30 210 3.0E-10
sp|D1BHT9|PSB_SANKS Proteasome subunit beta OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) GN=prcB PE=3 SV=1 29 199 3.0E-10
sp|A9WSI1|PSB_RENSM Proteasome subunit beta OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=prcB PE=3 SV=1 22 199 3.0E-10
sp|A1R6Q7|PSB_ARTAT Proteasome subunit beta OS=Arthrobacter aurescens (strain TC1) GN=prcB PE=3 SV=2 12 199 8.0E-10
sp|C7LYP7|PSB_ACIFD Proteasome subunit beta OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=prcB PE=3 SV=1 2 200 8.0E-10
sp|C5A2C2|PSA_THEGJ Proteasome subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmA PE=3 SV=1 24 184 9.0E-10
sp|A6VIP0|PSA_METM7 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmA PE=3 SV=1 24 207 2.0E-09
sp|A4X744|PSB2_SALTO Proteasome subunit beta 2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=prcB2 PE=3 SV=2 21 199 2.0E-09
sp|A4FZT6|PSA_METM5 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmA PE=3 SV=1 24 207 2.0E-09
sp|Q6M0L9|PSA_METMP Proteasome subunit alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=psmA PE=3 SV=1 24 207 2.0E-09
sp|A5LHX3|PSB11_HUMAN Proteasome subunit beta type-11 OS=Homo sapiens GN=PSMB11 PE=2 SV=1 29 204 2.0E-09
sp|D1A2S9|PSB1_THECD Proteasome subunit beta 1 OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=prcB1 PE=3 SV=1 17 199 2.0E-09
sp|Q42134|PSA5B_ARATH Proteasome subunit alpha type-5-B OS=Arabidopsis thaliana GN=PAE2 PE=1 SV=2 24 208 3.0E-09
sp|Q9R1P1|PSB3_MOUSE Proteasome subunit beta type-3 OS=Mus musculus GN=Psmb3 PE=1 SV=1 41 213 3.0E-09
sp|O81149|PSA5A_ARATH Proteasome subunit alpha type-5-A OS=Arabidopsis thaliana GN=PAE1 PE=1 SV=1 24 208 3.0E-09
sp|Q9M4T8|PSA5_SOYBN Proteasome subunit alpha type-5 OS=Glycine max GN=PAE1 PE=2 SV=1 24 208 4.0E-09
sp|P40112|PSB3_RAT Proteasome subunit beta type-3 OS=Rattus norvegicus GN=Psmb3 PE=1 SV=1 41 213 4.0E-09
sp|A9A846|PSA_METM6 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmA PE=3 SV=1 24 207 4.0E-09
sp|B6YXV3|PSB2_THEON Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 40 213 4.0E-09
sp|P23638|PSA3_YEAST Proteasome subunit alpha type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE9 PE=1 SV=1 24 184 6.0E-09
sp|Q5V1D4|PSA2_HALMA Proteasome subunit alpha 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA2 PE=3 SV=1 1 210 8.0E-09
sp|Q5V4S6|PSB1_HALMA Proteasome subunit beta 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB1 PE=3 SV=1 40 210 8.0E-09
sp|C7R403|PSB_JONDD Proteasome subunit beta OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) GN=prcB PE=3 SV=1 29 188 9.0E-09
sp|B6YSH9|PSA_THEON Proteasome subunit alpha OS=Thermococcus onnurineus (strain NA1) GN=psmA PE=3 SV=1 24 184 9.0E-09
sp|Q59565|PSA_METTE Proteasome subunit alpha OS=Methanosarcina thermophila GN=psmA PE=3 SV=1 24 223 9.0E-09
sp|A4FBY1|PSB_SACEN Proteasome subunit beta OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=prcB PE=3 SV=1 6 199 1.0E-08
sp|Q9V2V6|PSA1_HALVD Proteasome subunit alpha 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA1 PE=1 SV=2 24 210 1.0E-08
sp|P33672|PSB3_BOVIN Proteasome subunit beta type-3 OS=Bos taurus GN=PSMB3 PE=1 SV=3 41 213 1.0E-08
sp|B8H8L6|PSB_ARTCA Proteasome subunit beta OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=prcB PE=3 SV=1 6 199 1.0E-08
sp|A6URN9|PSA_METVS Proteasome subunit alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmA PE=3 SV=1 24 207 1.0E-08
sp|Q97BZ8|PSA_THEVO Proteasome subunit alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmA PE=3 SV=2 24 192 2.0E-08
sp|Q8TPX5|PSA_METAC Proteasome subunit alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmA PE=3 SV=1 24 220 2.0E-08
sp|P52427|PSA4_SPIOL Proteasome subunit alpha type-4 OS=Spinacia oleracea GN=PAC1 PE=2 SV=1 24 224 2.0E-08
sp|P40304|PSB1_DROME Proteasome subunit beta type-1 OS=Drosophila melanogaster GN=Prosbeta6 PE=2 SV=2 3 210 3.0E-08
sp|P25156|PSA_THEAC Proteasome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmA PE=1 SV=2 24 188 3.0E-08
sp|Q8PTU1|PSA_METMA Proteasome subunit alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmA PE=3 SV=1 24 216 3.0E-08
sp|Q47NZ4|PSB_THEFY Proteasome subunit beta OS=Thermobifida fusca (strain YX) GN=prcB PE=3 SV=1 26 199 4.0E-08
sp|P49720|PSB3_HUMAN Proteasome subunit beta type-3 OS=Homo sapiens GN=PSMB3 PE=1 SV=2 41 213 4.0E-08
sp|Q8BG41|PSB11_MOUSE Proteasome subunit beta type-11 OS=Mus musculus GN=Psmb11 PE=1 SV=1 29 204 5.0E-08
sp|C7NVQ4|PSB_HALMD Proteasome subunit beta OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=psmB PE=3 SV=1 41 210 6.0E-08
sp|Q469M6|PSA_METBF Proteasome subunit alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmA PE=3 SV=1 24 208 8.0E-08
sp|C3NEC6|PSA_SULIY Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmA PE=3 SV=1 24 190 1.0E-07
sp|C3NHC6|PSA_SULIN Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmA PE=3 SV=1 24 190 1.0E-07
sp|C3MVG1|PSA_SULIM Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmA PE=3 SV=1 24 190 1.0E-07
sp|C3MQ43|PSA_SULIL Proteasome subunit alpha OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmA PE=3 SV=1 24 190 1.0E-07
sp|C4KHD9|PSA_SULIK Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmA PE=3 SV=1 24 190 1.0E-07
sp|C3N5R0|PSA_SULIA Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.27) GN=psmA PE=3 SV=1 24 190 1.0E-07
sp|A4TB64|PSB_MYCGI Proteasome subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=prcB PE=3 SV=1 6 199 1.0E-07
sp|P42742|PSB1_ARATH Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2 16 215 1.0E-07
sp|A6W970|PSB_KINRD Proteasome subunit beta OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=prcB PE=3 SV=1 30 199 2.0E-07
sp|C7PVV2|PSB_CATAD Proteasome subunit beta OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=prcB PE=3 SV=1 19 199 2.0E-07
sp|B1W306|PSB_STRGG Proteasome subunit beta OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=prcB PE=3 SV=1 29 199 2.0E-07
sp|A7I9C7|PSA_METB6 Proteasome subunit alpha OS=Methanoregula boonei (strain 6A8) GN=psmA PE=3 SV=1 24 188 2.0E-07
sp|P23639|PSA2_YEAST Proteasome subunit alpha type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE8 PE=1 SV=1 25 245 2.0E-07
sp|Q9U793|PSA2_TRYBB Proteasome subunit alpha type-2 OS=Trypanosoma brucei brucei PE=2 SV=1 25 215 3.0E-07
sp|Q23237|PSB3_CAEEL Proteasome subunit beta type-3 OS=Caenorhabditis elegans GN=pbs-3 PE=1 SV=1 28 214 3.0E-07
sp|Q94561|PSA5_ENTHI Proteasome subunit alpha type-5 OS=Entamoeba histolytica PE=3 SV=2 24 211 4.0E-07
sp|Q828I8|PSB2_STRAW Proteasome subunit beta 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prcB2 PE=3 SV=1 29 199 5.0E-07
sp|Q7AKQ5|PSB_STRCO Proteasome subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prcB PE=1 SV=1 29 205 9.0E-07
sp|O82530|PSA4_PETHY Proteasome subunit alpha type-4 OS=Petunia hybrida GN=PAC1 PE=2 SV=1 24 184 1.0E-06
sp|C9Z4D0|PSB_STRSW Proteasome subunit beta OS=Streptomyces scabiei (strain 87.22) GN=prcB PE=3 SV=1 29 199 1.0E-06
sp|Q9VQE5|PSB2_DROME Probable proteasome subunit beta type-2 OS=Drosophila melanogaster GN=Prosbeta4R2 PE=2 SV=3 31 189 1.0E-06
sp|B8GEZ3|PSA_METPE Proteasome subunit alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmA PE=3 SV=1 24 190 2.0E-06
sp|D2Q4H4|PSB_KRIFD Proteasome subunit beta OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) GN=prcB PE=3 SV=1 29 181 2.0E-06
sp|A4YCU9|PSA_METS5 Proteasome subunit alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmA PE=3 SV=1 24 210 2.0E-06
sp|Q8SRF1|PSB4_ENCCU Probable proteasome subunit beta type-4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE1 PE=1 SV=1 42 183 2.0E-06
sp|Q95083|PSA5_DROME Proteasome subunit alpha type-5 OS=Drosophila melanogaster GN=Prosalpha5 PE=2 SV=2 24 215 2.0E-06
sp|A1SK13|PSB_NOCSJ Proteasome subunit beta OS=Nocardioides sp. (strain BAA-499 / JS614) GN=prcB PE=3 SV=1 29 199 2.0E-06
sp|Q9UXC6|PSA_SULSO Proteasome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmA PE=3 SV=1 24 190 3.0E-06
sp|D2S6E2|PSB_GEOOG Proteasome subunit beta OS=Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / G-20) GN=prcB PE=3 SV=1 20 199 3.0E-06
sp|D0LDT1|PSB_GORB4 Proteasome subunit beta OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=prcB PE=3 SV=1 3 199 3.0E-06
sp|Q7DLR9|PSB4_ARATH Proteasome subunit beta type-4 OS=Arabidopsis thaliana GN=PBG1 PE=1 SV=2 28 218 3.0E-06
sp|Q6L0W3|PSA_PICTO Proteasome subunit alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmA PE=3 SV=1 24 195 4.0E-06
sp|D2ATV1|PSB_STRRD Proteasome subunit beta OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) GN=prcB PE=3 SV=1 10 181 4.0E-06
sp|Q5VRG3|PSA4B_ORYSJ Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. japonica GN=Os06g0167600 PE=2 SV=1 24 229 5.0E-06
sp|P0C8Y9|PSA4B_ORYSI Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. indica GN=OsI_021067 PE=1 SV=1 24 229 5.0E-06
sp|Q55G04|PSA5_DICDI Proteasome subunit alpha type-5 OS=Dictyostelium discoideum GN=psmA5 PE=3 SV=1 33 209 7.0E-06
sp|P0C1G8|PSA4A_ORYSJ Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. japonica GN=PAC1 PE=2 SV=1 24 229 8.0E-06
sp|A2Y9X7|PSA4A_ORYSI Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. indica GN=OsI_021120 PE=1 SV=2 24 229 8.0E-06
sp|Q54DM7|PSA2_DICDI Proteasome subunit alpha type-2 OS=Dictyostelium discoideum GN=psmA2 PE=3 SV=1 24 211 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0051603 proteolysis involved in protein catabolic process Yes
GO:0005839 proteasome core complex Yes
GO:0019538 protein metabolic process No
GO:0006508 proteolysis No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3937
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7971
Ophiocordyceps australis map64 (Brazil) OphauB2|2934
Ophiocordyceps camponoti-floridani Ophcf2|04421
Ophiocordyceps camponoti-rufipedis Ophun1|4380 (this protein)
Ophiocordyceps kimflemingae Ophio5|343
Ophiocordyceps subramaniannii Hirsu2|7838

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4380
MPGFDFSNYNRNAALHAKGVPLPQATSTGTTIVGCIFDGGVVIAADTRATSGPIVADKNCEKLHYISPQIWCAGA
GTAADTEFTTSLISSQLELHSLSTGRKPRVVTCMTLLKQHLFRHQGHIGAYLVVAGCDPTGTHLFTVHAHGSTDK
LPYVTMGSGSLAAMSVFETQWKPQLTREDAVKLASDAILAGIFNDLGSGSNVDVAVISKEKTTLMRNYIKPNEKS
AKLQSYAFPKGTTAVLNQKIIKKSEMSQYISVQEVPLEAEKMDVDP*
Coding >Ophun1|4380
ATGCCGGGCTTCGACTTCTCCAACTACAACCGCAATGCGGCCCTGCACGCCAAGGGCGTCCCTCTGCCCCAGGCC
ACCAGCACGGGCACGACGATTGTCGGATGCATCTTTGACGGGGGCGTCGTGATCGCAGCAGACACCCGCGCAACC
TCAGGCCCCATCGTCGCCGACAAAAACTGCGAGAAGCTTCACTACATCTCCCCCCAAATCTGGTGCGCCGGCGCC
GGCACCGCCGCCGACACCGAATTCACCACCAGCCTCATCTCCTCCCAGCTCGAGCTCCATTCCCTCTCCACCGGC
CGCAAGCCCCGCGTCGTCACCTGCATGACGCTCCTCAAGCAGCACCTGTTTCGTCACCAGGGCCACATCGGCGCC
TACCTCGTCGTCGCCGGCTGCGATCCCACCGGCACCCATCTCTTCACCGTTCACGCCCATGGCAGCACCGATAAG
CTGCCCTACGTCACCATGGGTAGCGGCAGCTTGGCCGCCATGAGCGTCTTTGAGACCCAGTGGAAGCCTCAGCTG
ACGCGTGAAGACGCCGTCAAGCTCGCCAGCGACGCCATCTTGGCCGGCATCTTCAATGATCTGGGCTCCGGCTCC
AATGTCGATGTGGCCGTCATCAGCAAGGAGAAGACGACTCTCATGCGCAACTACATCAAGCCCAACGAGAAGAGC
GCAAAGCTTCAGAGCTACGCCTTCCCCAAGGGCACCACCGCCGTCCTCAACCAAAAGATTATCAAGAAGAGCGAG
ATGAGCCAATACATCAGCGTCCAGGAAGTGCCGCTCGAGGCTGAGAAGATGGACGTCGACCCTTGA
Transcript >Ophun1|4380
ATGCCGGGCTTCGACTTCTCCAACTACAACCGCAATGCGGCCCTGCACGCCAAGGGCGTCCCTCTGCCCCAGGCC
ACCAGCACGGGCACGACGATTGTCGGATGCATCTTTGACGGGGGCGTCGTGATCGCAGCAGACACCCGCGCAACC
TCAGGCCCCATCGTCGCCGACAAAAACTGCGAGAAGCTTCACTACATCTCCCCCCAAATCTGGTGCGCCGGCGCC
GGCACCGCCGCCGACACCGAATTCACCACCAGCCTCATCTCCTCCCAGCTCGAGCTCCATTCCCTCTCCACCGGC
CGCAAGCCCCGCGTCGTCACCTGCATGACGCTCCTCAAGCAGCACCTGTTTCGTCACCAGGGCCACATCGGCGCC
TACCTCGTCGTCGCCGGCTGCGATCCCACCGGCACCCATCTCTTCACCGTTCACGCCCATGGCAGCACCGATAAG
CTGCCCTACGTCACCATGGGTAGCGGCAGCTTGGCCGCCATGAGCGTCTTTGAGACCCAGTGGAAGCCTCAGCTG
ACGCGTGAAGACGCCGTCAAGCTCGCCAGCGACGCCATCTTGGCCGGCATCTTCAATGATCTGGGCTCCGGCTCC
AATGTCGATGTGGCCGTCATCAGCAAGGAGAAGACGACTCTCATGCGCAACTACATCAAGCCCAACGAGAAGAGC
GCAAAGCTTCAGAGCTACGCCTTCCCCAAGGGCACCACCGCCGTCCTCAACCAAAAGATTATCAAGAAGAGCGAG
ATGAGCCAATACATCAGCGTCCAGGAAGTGCCGCTCGAGGCTGAGAAGATGGACGTCGACCCTTGA
Gene >Ophun1|4380
ATGCCGGGCTTCGACTTCTCCAACTACAACCGCAATGCGGCCCTGCACGCCAAGGGCGTCCCTCTGCCCCAGGCC
ACCAGCACGGGCACGACGATTGTCGGATGCATCTTTGACGGGGGCGTCGTGGTCCGTATCCCTCCTCTATAGCTT
TTCTCTTTTTCAGAATCTGATATGCCCCAGATCGCAGCAGACACCCGCGCAACCTCAGGCCCCATCGTCGCCGAC
AAAAACTGCGAGAAGCTTCACTACATCTCCCCCCAAATCTGGTGCGCCGGCGCCGGCACCGCCGCCGACACCGAA
TTCACCACCAGCCTCATCTCCTCCCAGCTCGAGCTCCATTCCCTCTCCACCGGCCGCAAGCCCCGCGTCGTCACC
TGCATGACGCTCCTCAAGCAGCACCTGTTTCGTCACCAGGGCCACATCGGCGCCTACCTCGTCGTCGCCGGCTGC
GATCCCACCGGCACCCATCTCTTCACCGTTCACGCCCATGGCAGCACCGATAAGCTGCCCTACGTCACCATGGGT
AGCGGCAGCTTGGCCGCCATGAGCGTCTTTGAGACCCAGTGGAAGCCTCAGCTGACGCGTGAAGACGCCGTCAAG
CTCGCCAGCGACGCCATCTTGGCCGGCATCTTCAATGATCTGGGCTCCGGCTCCAATGTCGATGTGGCCGTCATC
AGCAAGGAGAAGACGACTCTCATGCGCAACTACATCAAGCCCAACGAGAAGAGCGCAAAGCTTCAGAGCTACGCC
TTCCCCAAGGGCACCACCGCCGTCCTCAACCAAAAGATTATCAAGAAGAGCGAGATGAGCCAATACATCAGCGTC
CAGGAAGTGCCGCTCGAGGCTGAGAAGATGGACGTCGACCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail