Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4370
Gene name
LocationContig_40:52821..55195
Strand-
Gene length (bp)2374
Transcript length (bp)2145
Coding sequence length (bp)2145
Protein length (aa) 715

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 2.0E-13 291 448

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 28 510 3.0E-37
sp|P21657|DAL81_YEAST Transcriptional activator protein DAL81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL81 PE=1 SV=3 205 657 1.0E-30
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 206 520 2.0E-21
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 286 650 1.0E-14
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 244 671 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA7|YL8B_SCHPO Uncharacterized transcriptional regulatory protein C25B8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.11 PE=3 SV=1 28 510 3.0E-37
sp|P21657|DAL81_YEAST Transcriptional activator protein DAL81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL81 PE=1 SV=3 205 657 1.0E-30
sp|Q9P7H9|YIT3_SCHPO Uncharacterized transcriptional regulatory protein C105.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC105.03c PE=3 SV=1 206 520 2.0E-21
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 286 650 1.0E-14
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 244 671 7.0E-12
sp|Q4WK35|AMDR_ASPFU Acetamidase regulatory protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=amdR PE=3 SV=1 249 577 1.0E-07
sp|Q06157|AMDR_ASPOR Acetamidase regulatory protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amdR PE=2 SV=2 249 577 2.0E-07
sp|P08657|LAC9_KLULA Lactose regulatory protein LAC9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC9 PE=1 SV=1 289 443 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046872 metal ion binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0043169 cation binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0032774 RNA biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 631 648 17

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4370
MNGGDDAAAALGQGGGPHGRPRKFVIQSTFGNPRERRSRKNRPCDACRRRKTACVITSEPPCLFCQSRGIVCQSS
PAASPASQQQEQQEQQTDQQQRQTPHHHHGRHALPPSSPQSTELPTPSTSSTHDSPEVMTSPFGRAAVVHQNLVG
QASPVTDDLEAAAGVTAAAGTSAVGVGGPGEPMPAAAPPGPTTGCTTLEDVAGWAAYYMGPTAEQDTFLLDAFRY
GILSEGYNVDANIVRVHPGGSQPDDRPTHFLFLEVGHPDHVNRARQAASDAIEAKVWPYGERLVRLYFRHVHPVL
PIVSKGRFLRRYHADKKGVPACLRGALYALASVFWVGTPCPFQQHELVDHAHAALRREIENPNLFVLQACLLLIH
VTPPAIDCMEAPTTWTLAAQATACSQLIGLHQEPGQWTVEPVEKRLRRRLWWAVFVTDCWSSICHGCPPHVHAGS
FNTGPPVMDDLRADELVPDDLRYLVEPPDTDFQVSSGARFLEMVNISRYLRTVLDSSFQVNTGAMTAEDRIQAQT
DLVAVQAKLRDWPSLLPSCLVIKHEERRRSPVTSYNCPLHLSFYASQVLLYRALMYPPTRAAKTTPGSNLRKWFP
AALAEFESFAEFLTCINKHDLFGFWGRHARSHLILCGNFLIYLFLLAWERRDIERAYRLLESFHQTMHELHDYDN
VQAKSLLRAATLRIDSFFTQAAQIMRQGGEGTVSSILNP*
Coding >Ophun1|4370
ATGAATGGCGGCGATGACGCAGCCGCAGCTCTCGGCCAGGGCGGCGGTCCCCACGGCCGGCCTCGCAAGTTTGTC
ATCCAGAGCACCTTTGGGAATCCGAGGGAGCGAAGGAGCCGCAAGAACAGGCCCTGTGATGCCTGTCGTCGGCGG
AAGACGGCGTGCGTCATCACGTCAGAGCCACCGTGTCTCTTTTGCCAGAGCCGCGGCATCGTCTGCCAGTCCTCG
CCCGCTGCGTCTCCGGCATCACAGCAGCAAGAGCAGCAAGAGCAGCAGACAGACCAGCAGCAACGACAGACTCCC
CATCATCACCATGGCCGACATGCCCTGCCCCCGAGCTCGCCGCAGTCGACGGAGCTGCCGACTCCGAGCACCAGC
TCGACACACGACAGCCCCGAGGTCATGACATCGCCCTTTGGTCGTGCCGCTGTCGTGCACCAGAACCTCGTCGGC
CAGGCCAGTCCCGTTACCGACGACCTTGAAGCAGCCGCGGGGGTGACAGCGGCGGCGGGGACGTCGGCGGTCGGA
GTCGGAGGTCCGGGAGAGCCGATGCCGGCCGCGGCCCCCCCCGGCCCCACTACCGGATGCACTACTCTCGAGGAC
GTCGCCGGTTGGGCCGCCTATTACATGGGTCCGACGGCGGAGCAGGATACGTTTCTTCTCGATGCCTTCCGATAC
GGTATCCTCAGCGAGGGCTACAACGTCGACGCCAACATCGTCCGTGTCCATCCAGGAGGCTCTCAGCCCGATGAC
CGGCCCACGCACTTCCTCTTCCTCGAAGTCGGCCATCCGGATCACGTCAATCGGGCCCGTCAGGCGGCCTCGGAT
GCCATCGAGGCCAAGGTCTGGCCCTACGGCGAGCGACTGGTGCGTCTCTACTTCCGGCACGTCCATCCAGTGCTT
CCCATCGTCTCCAAGGGCCGCTTCTTGCGCCGCTATCACGCCGACAAGAAGGGCGTTCCCGCCTGTCTCCGCGGT
GCGCTCTATGCACTGGCCTCGGTCTTCTGGGTCGGTACGCCGTGTCCGTTCCAGCAGCATGAGCTCGTCGATCAC
GCGCACGCCGCGTTGAGGCGGGAGATTGAGAATCCCAATCTCTTTGTGCTGCAGGCCTGTTTGCTGCTCATTCAC
GTCACTCCCCCGGCCATTGACTGCATGGAAGCTCCCACAACATGGACGCTGGCTGCTCAGGCAACGGCCTGTTCG
CAGCTCATCGGCTTGCATCAGGAACCTGGTCAGTGGACCGTTGAGCCCGTTGAAAAGAGGCTGCGTCGTCGTCTT
TGGTGGGCCGTCTTCGTCACAGATTGTTGGTCTTCCATCTGTCATGGCTGCCCACCTCACGTCCATGCCGGTTCT
TTCAACACGGGGCCACCCGTTATGGACGATCTACGGGCCGACGAGCTCGTACCGGATGATCTGCGCTATCTCGTC
GAGCCGCCGGATACCGACTTTCAAGTCTCGTCCGGTGCTCGCTTCCTCGAGATGGTGAATATATCTCGCTACCTG
CGGACGGTGCTGGACTCGAGCTTCCAAGTCAACACCGGGGCCATGACCGCCGAAGACAGAATCCAGGCGCAGACC
GACCTTGTTGCCGTTCAGGCCAAGCTCCGCGACTGGCCGAGTCTGCTACCGTCGTGTCTCGTCATCAAGCACGAA
GAACGGCGCAGATCCCCCGTCACTTCGTACAACTGCCCCCTCCATCTGTCCTTTTACGCTTCTCAGGTGCTGCTA
TATCGCGCCCTCATGTATCCGCCCACCCGTGCGGCCAAGACGACACCCGGCTCCAACCTCCGGAAGTGGTTCCCG
GCCGCCTTGGCCGAGTTTGAGTCGTTTGCCGAGTTTCTCACCTGCATCAACAAGCACGACCTGTTTGGTTTCTGG
GGTCGACATGCCCGTTCGCATCTGATACTCTGTGGAAACTTCCTCATCTATCTGTTTCTGCTGGCGTGGGAGCGG
AGAGACATTGAGCGAGCCTACCGCCTCCTCGAGAGCTTCCATCAGACGATGCACGAGCTGCACGATTACGACAAC
GTCCAAGCAAAGTCGCTGCTCCGTGCTGCCACCCTGCGAATCGACTCCTTCTTCACGCAGGCAGCTCAGATTATG
CGCCAGGGCGGCGAAGGGACCGTCTCATCCATCCTGAACCCGTGA
Transcript >Ophun1|4370
ATGAATGGCGGCGATGACGCAGCCGCAGCTCTCGGCCAGGGCGGCGGTCCCCACGGCCGGCCTCGCAAGTTTGTC
ATCCAGAGCACCTTTGGGAATCCGAGGGAGCGAAGGAGCCGCAAGAACAGGCCCTGTGATGCCTGTCGTCGGCGG
AAGACGGCGTGCGTCATCACGTCAGAGCCACCGTGTCTCTTTTGCCAGAGCCGCGGCATCGTCTGCCAGTCCTCG
CCCGCTGCGTCTCCGGCATCACAGCAGCAAGAGCAGCAAGAGCAGCAGACAGACCAGCAGCAACGACAGACTCCC
CATCATCACCATGGCCGACATGCCCTGCCCCCGAGCTCGCCGCAGTCGACGGAGCTGCCGACTCCGAGCACCAGC
TCGACACACGACAGCCCCGAGGTCATGACATCGCCCTTTGGTCGTGCCGCTGTCGTGCACCAGAACCTCGTCGGC
CAGGCCAGTCCCGTTACCGACGACCTTGAAGCAGCCGCGGGGGTGACAGCGGCGGCGGGGACGTCGGCGGTCGGA
GTCGGAGGTCCGGGAGAGCCGATGCCGGCCGCGGCCCCCCCCGGCCCCACTACCGGATGCACTACTCTCGAGGAC
GTCGCCGGTTGGGCCGCCTATTACATGGGTCCGACGGCGGAGCAGGATACGTTTCTTCTCGATGCCTTCCGATAC
GGTATCCTCAGCGAGGGCTACAACGTCGACGCCAACATCGTCCGTGTCCATCCAGGAGGCTCTCAGCCCGATGAC
CGGCCCACGCACTTCCTCTTCCTCGAAGTCGGCCATCCGGATCACGTCAATCGGGCCCGTCAGGCGGCCTCGGAT
GCCATCGAGGCCAAGGTCTGGCCCTACGGCGAGCGACTGGTGCGTCTCTACTTCCGGCACGTCCATCCAGTGCTT
CCCATCGTCTCCAAGGGCCGCTTCTTGCGCCGCTATCACGCCGACAAGAAGGGCGTTCCCGCCTGTCTCCGCGGT
GCGCTCTATGCACTGGCCTCGGTCTTCTGGGTCGGTACGCCGTGTCCGTTCCAGCAGCATGAGCTCGTCGATCAC
GCGCACGCCGCGTTGAGGCGGGAGATTGAGAATCCCAATCTCTTTGTGCTGCAGGCCTGTTTGCTGCTCATTCAC
GTCACTCCCCCGGCCATTGACTGCATGGAAGCTCCCACAACATGGACGCTGGCTGCTCAGGCAACGGCCTGTTCG
CAGCTCATCGGCTTGCATCAGGAACCTGGTCAGTGGACCGTTGAGCCCGTTGAAAAGAGGCTGCGTCGTCGTCTT
TGGTGGGCCGTCTTCGTCACAGATTGTTGGTCTTCCATCTGTCATGGCTGCCCACCTCACGTCCATGCCGGTTCT
TTCAACACGGGGCCACCCGTTATGGACGATCTACGGGCCGACGAGCTCGTACCGGATGATCTGCGCTATCTCGTC
GAGCCGCCGGATACCGACTTTCAAGTCTCGTCCGGTGCTCGCTTCCTCGAGATGGTGAATATATCTCGCTACCTG
CGGACGGTGCTGGACTCGAGCTTCCAAGTCAACACCGGGGCCATGACCGCCGAAGACAGAATCCAGGCGCAGACC
GACCTTGTTGCCGTTCAGGCCAAGCTCCGCGACTGGCCGAGTCTGCTACCGTCGTGTCTCGTCATCAAGCACGAA
GAACGGCGCAGATCCCCCGTCACTTCGTACAACTGCCCCCTCCATCTGTCCTTTTACGCTTCTCAGGTGCTGCTA
TATCGCGCCCTCATGTATCCGCCCACCCGTGCGGCCAAGACGACACCCGGCTCCAACCTCCGGAAGTGGTTCCCG
GCCGCCTTGGCCGAGTTTGAGTCGTTTGCCGAGTTTCTCACCTGCATCAACAAGCACGACCTGTTTGGTTTCTGG
GGTCGACATGCCCGTTCGCATCTGATACTCTGTGGAAACTTCCTCATCTATCTGTTTCTGCTGGCGTGGGAGCGG
AGAGACATTGAGCGAGCCTACCGCCTCCTCGAGAGCTTCCATCAGACGATGCACGAGCTGCACGATTACGACAAC
GTCCAAGCAAAGTCGCTGCTCCGTGCTGCCACCCTGCGAATCGACTCCTTCTTCACGCAGGCAGCTCAGATTATG
CGCCAGGGCGGCGAAGGGACCGTCTCATCCATCCTGAACCCGTGA
Gene >Ophun1|4370
ATGAATGGCGGCGATGACGCAGCCGCAGCTCTCGGCCAGGGCGGCGGTCCCCACGGCCGGCCTCGCAAGTTTGTC
ATCCAGAGCACCTTTGGGAATCCGAGGGAGCGAAGGAGCCGCAAGAACAGGCCCTGTGATGCCTGTCGTCGGCGG
AAGACGGCGTGCGTCATCACGTCAGAGCCACCGTGTAAGTCCAACTCTAAACCCTTGTCTCGCTACGGCCCAGCT
GACCATGGCTGTCAGGTCTCTTTTGCCAGAGCCGCGGCATCGTCTGCCAGTCCTCGCCCGCTGCGTCTCCGGCAT
CACAGCAGCAAGAGCAGCAAGAGCAGCAGACAGACCAGCAGCAACGACAGACTCCCCATCATCACCATGGCCGAC
ATGCCCTGCCCCCGAGCTCGCCGCAGTCGACGGAGCTGCCGACTCCGAGCACCAGCTCGACACACGACAGCCCCG
AGGTCATGACATCGCCCTTTGGTCGTGCCGCTGTCGTGCACCAGAACCTCGTCGGCCAGGCCAGTCCCGTTACCG
ACGACCTTGAAGCAGCCGCGGGGGTGACAGCGGCGGCGGGGACGTCGGCGGTCGGAGTCGGAGGTCCGGGAGAGC
CGATGCCGGCCGCGGCCCCCCCCGGCCCCACTACCGGATGCACTACTCTCGAGGACGTCGCCGGTTGGGCCGCCT
ATTACATGGGTCCGACGGCGGAGCAGGATACGTTTCTTCTCGATGCCTTCCGATACGGTATCCTCAGCGAGGGCT
ACAACGTCGACGCCAACATCGTCCGTGTCCATCCAGGAGGCTCTCAGCCCGATGACCGGCCCACGCACTTCCTCT
TCCTCGAAGTCGGCCATCCGGATCACGTCAATCGGGCCCGTCAGGCGGCCTCGGATGCCATCGAGGCCAAGGTCT
GGCCCTACGGCGAGCGACTGGTGCGTCTCTACTTCCGGCACGTCCATCCAGTGCTTCCCATCGTCTCCAAGGGCC
GCTTCTTGCGCCGCTATCACGCCGACAAGAAGGGCGTTCCCGCCTGTCTCCGCGGTGCGCTCTATGCACTGGCCT
CGGTCTTCTGGGTCGGTACGCCGTGTCCGTTCCAGCAGCATGAGCTCGTCGATCACGCGCACGCCGCGTTGAGGC
GGGAGATTGAGAATCCCAATCTCTTTGTGCTGCAGGCCTGTTTGCTGCTCATTCACGTCACTCCCCCGGCCATTG
ACTGCATGGAAGCTCCCACAACATGGACGCTGGCTGCTCAGGCAACGGCCTGTTCGCAGCTCATCGGCTTGCATC
AGGAACCTGGTCAGTGGACCGTTGAGCCCGTTGAAAAGAGGCTGCGTCGTCGTCTTTGGTGGGCCGTCTTCGTCA
CAGATTGTTGGTCTTCCATCTGTCATGGCTGCCCACCTCACGTCCATGCCGGTTCTTTCAACACGGGGCCACCCG
TTATGGACGATCTACGGGCCGACGAGCTCGTACCGGATGATCTGCGCTATCTCGTCGAGCCGCCGGATACCGACT
TTCAAGTCTCGTCCGGTGCTCGCTTCCTCGAGATGGTGAATATATCTCGCTACCTGCGGACGGTGCTGGACTCGA
GCTTGTAAGTCGTCGACTGCTTCCAGCTAGACATTCTCCTGATGACTTGTCCCAGCCAAGTCAACACCGGGGCCA
TGACCGCCGAAGACAGAATCCAGGCGCAGACCGACCTTGTTGCCGTTCAGGCCAAGCTCCGCGACTGGCCGAGTC
TGCTACCGTCGTGTCTCGTCATCAAGCACGAAGAACGGCGCAGATCCCCCGTCACTTCGTACAACTGTGCGTCTC
GGACTGCTCTCGTTACTATGTGTGAGACTCGTCTGACATGCGCATTTCAGGCCCCCTCCATCTGTCCTTTTACGC
TTCTCAGGTGCTGCTATATCGCGCCCTCATGTATCCGCCCACCCGTGCGGCCAAGACGACACCCGGCTCCAACCT
CCGGAAGTGGTTCCCGGCCGCCTTGGCCGAGTTTGAGTCGTTTGCCGAGTTTCTCACCTGCATCAACAAGCACGA
CCTGTTTGGTTTCTGGGGTCGACGTACGTGCTTGGATGCATCCTGCTCCCTGTGTCGGCTCGAACTGACAGTTGA
GTTGCTCGCAGATGCCCGTTCGCATCTGATACTCTGTGGAAACTTCCTCATCTATCTGTTTCTGCTGGCGTGGGA
GCGGAGAGACATTGAGCGAGCCTACCGCCTCCTCGAGAGCTTCCATCAGACGATGCACGAGCTGCACGATTACGA
CAACGTCCAAGCAAAGTCGCTGCTCCGTGCTGCCACCCTGCGAATCGACTCCTTCTTCACGCAGGCAGCTCAGAT
TATGCGCCAGGGCGGCGAAGGGACCGTCTCATCCATCCTGAACCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail