Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|436
Gene name
LocationContig_112:24457..26424
Strand-
Gene length (bp)1967
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 5.5E-75 156 546

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 48 595 8.0E-122
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 46 590 1.0E-111
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 47 577 2.0E-96
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 79 549 2.0E-33
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 79 553 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 48 595 8.0E-122
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 46 590 1.0E-111
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 47 577 2.0E-96
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 79 549 2.0E-33
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 79 553 1.0E-32
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 75 553 2.0E-32
sp|Q91W98|S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus GN=Slc15a4 PE=1 SV=1 75 553 5.0E-32
sp|Q8N697|S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens GN=SLC15A4 PE=2 SV=1 75 527 5.0E-31
sp|Q9LFB8|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana GN=NPF8.2 PE=2 SV=1 46 529 1.0E-30
sp|P46032|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1 79 534 8.0E-30
sp|P36836|S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus GN=SLC15A1 PE=2 SV=1 71 469 3.0E-29
sp|Q84WG0|PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana GN=NPF8.4 PE=2 SV=2 79 570 1.0E-28
sp|Q93Z20|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana GN=NPF8.5 PE=2 SV=1 79 536 5.0E-28
sp|A6QQL0|S15A4_BOVIN Solute carrier family 15 member 4 OS=Bos taurus GN=SLC15A4 PE=2 SV=2 75 527 1.0E-27
sp|P46059|S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens GN=SLC15A1 PE=2 SV=1 71 462 2.0E-27
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 71 462 3.0E-26
sp|P51574|S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus GN=Slc15a1 PE=2 SV=1 71 462 7.0E-26
sp|Q9JIP7|S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus GN=Slc15a1 PE=1 SV=2 71 554 1.0E-25
sp|Q9ES07|S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus GN=Slc15a2 PE=1 SV=1 74 457 7.0E-24
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 74 457 8.0E-24
sp|P46029|S15A2_RABIT Solute carrier family 15 member 2 OS=Oryctolagus cuniculus GN=SLC15A2 PE=2 SV=1 74 462 2.0E-23
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 70 462 3.0E-23
sp|Q16348|S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens GN=SLC15A2 PE=2 SV=2 74 462 1.0E-21
sp|Q9FNL8|PTR4_ARATH Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana GN=NPF5.3 PE=2 SV=1 41 534 1.0E-20
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 74 427 2.0E-19
sp|Q9LVE0|PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4 OS=Arabidopsis thaliana GN=NPF6.4 PE=1 SV=1 39 535 3.0E-19
sp|Q0WSZ6|PTR23_ARATH Protein NRT1/ PTR FAMILY 5.13 OS=Arabidopsis thaliana GN=NPF5.13 PE=2 SV=2 41 529 5.0E-19
sp|Q9FNL7|PTR3_ARATH Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana GN=NPF5.2 PE=2 SV=1 41 540 1.0E-18
sp|O01840|PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans GN=pept-3 PE=1 SV=1 79 459 2.0E-18
sp|Q924V4|S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus GN=Slc15a3 PE=2 SV=1 244 549 7.0E-18
sp|Q0WP01|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10 OS=Arabidopsis thaliana GN=NPF5.10 PE=2 SV=1 48 565 2.0E-17
sp|Q8BPX9|S15A3_MOUSE Solute carrier family 15 member 3 OS=Mus musculus GN=Slc15a3 PE=2 SV=1 244 549 4.0E-17
sp|Q9M331|PTR45_ARATH Protein NRT1/ PTR FAMILY 5.7 OS=Arabidopsis thaliana GN=NPF5.7 PE=2 SV=2 78 537 8.0E-17
sp|Q9FM20|PTR54_ARATH Protein NRT1/ PTR FAMILY 4.7 OS=Arabidopsis thaliana GN=NPF4.7 PE=2 SV=2 116 545 2.0E-16
sp|P0CI03|PTR28_ARATH Protein NRT1/ PTR FAMILY 5.6 OS=Arabidopsis thaliana GN=NPF5.6 PE=2 SV=1 38 537 2.0E-16
sp|Q9C7U1|PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12 OS=Arabidopsis thaliana GN=NPF5.12 PE=2 SV=1 48 548 4.0E-16
sp|Q17758|PEPT2_CAEEL Peptide transporter family 2 OS=Caenorhabditis elegans GN=pept-2 PE=1 SV=2 38 469 4.0E-16
sp|Q8IY34|S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=2 75 549 5.0E-16
sp|Q8VYE4|PTR12_ARATH Protein NRT1/ PTR FAMILY 4.5 OS=Arabidopsis thaliana GN=NPF4.5 PE=2 SV=1 181 528 2.0E-15
sp|Q9M1I2|PTR46_ARATH Protein NRT1/ PTR FAMILY 5.4 OS=Arabidopsis thaliana GN=NPF5.4 PE=2 SV=1 75 554 2.0E-15
sp|Q8RX77|PTR21_ARATH Protein NRT1/ PTR FAMILY 2.13 OS=Arabidopsis thaliana GN=NPF2.13 PE=1 SV=1 137 582 3.0E-15
sp|Q8VZE2|PTR22_ARATH Protein NRT1/ PTR FAMILY 5.14 OS=Arabidopsis thaliana GN=NPF5.14 PE=2 SV=2 44 534 3.0E-15
sp|Q9LQL2|PTR14_ARATH Protein NRT1/ PTR FAMILY 7.3 OS=Arabidopsis thaliana GN=NPF7.3 PE=1 SV=2 139 534 7.0E-15
sp|Q9LFR1|PTR50_ARATH Protein NRT1/ PTR FAMILY 5.8 OS=Arabidopsis thaliana GN=NPF5.8 PE=2 SV=1 137 547 2.0E-14
sp|Q9LFX9|PTR13_ARATH Protein NRT1/ PTR FAMILY 2.12 OS=Arabidopsis thaliana GN=NPF2.12 PE=1 SV=2 133 572 3.0E-14
sp|Q8RX67|PTR24_ARATH Protein NRT1/ PTR FAMILY 5.11 OS=Arabidopsis thaliana GN=NPF5.11 PE=2 SV=1 39 581 3.0E-14
sp|Q9SK99|PTR11_ARATH Protein NRT1/ PTR FAMILY 5.15 OS=Arabidopsis thaliana GN=NPF5.15 PE=2 SV=1 47 536 2.0E-13
sp|Q8H157|PTR19_ARATH Protein NRT1/ PTR FAMILY 4.6 OS=Arabidopsis thaliana GN=NPF4.6 PE=1 SV=1 149 548 2.0E-13
sp|Q9SRI2|PTR31_ARATH Protein NRT1/ PTR FAMILY 5.9 OS=Arabidopsis thaliana GN=NPF5.9 PE=2 SV=1 137 548 8.0E-13
sp|Q3E9B5|PTR51_ARATH Protein NRT1/ PTR FAMILY 7.1 OS=Arabidopsis thaliana GN=NPF7.1 PE=2 SV=1 139 523 9.0E-13
sp|Q9M9V7|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9 OS=Arabidopsis thaliana GN=NPF2.9 PE=1 SV=1 143 527 2.0E-12
sp|Q9SZY4|PTR27_ARATH Protein NRT1/ PTR FAMILY 6.2 OS=Arabidopsis thaliana GN=NPF6.2 PE=1 SV=1 48 535 1.0E-10
sp|Q05085|PTR7_ARATH Protein NRT1/ PTR FAMILY 6.3 OS=Arabidopsis thaliana GN=NPF6.3 PE=1 SV=1 48 543 3.0E-10
sp|Q9SX20|PTR18_ARATH Protein NRT1/ PTR FAMILY 3.1 OS=Arabidopsis thaliana GN=NPF3.1 PE=2 SV=1 125 535 1.0E-09
sp|Q8LPL2|PTR32_ARATH Protein NRT1/ PTR FAMILY 1.1 OS=Arabidopsis thaliana GN=NPF1.1 PE=1 SV=2 47 590 2.0E-09
sp|Q8VZR7|PTR30_ARATH Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana GN=NPF5.1 PE=2 SV=2 48 291 4.0E-07
sp|Q9LYR6|PTR49_ARATH Protein NRT1/ PTR FAMILY 6.1 OS=Arabidopsis thaliana GN=NPF6.1 PE=2 SV=1 73 582 1.0E-06
sp|Q9LSF0|PTR34_ARATH Protein NRT1/ PTR FAMILY 4.1 OS=Arabidopsis thaliana GN=NPF4.1 PE=2 SV=1 124 523 1.0E-06
sp|P39276|DTPC_ECOLI Dipeptide and tripeptide permease C OS=Escherichia coli (strain K12) GN=dtpC PE=1 SV=1 71 299 4.0E-06
sp|Q3E8X3|PTR52_ARATH Protein NRT1/ PTR FAMILY 2.8 OS=Arabidopsis thaliana GN=NPF2.8 PE=2 SV=2 130 314 8.0E-06
sp|Q56XQ6|PTR15_ARATH Protein NRT1/ PTR FAMILY 4.4 OS=Arabidopsis thaliana GN=NPF4.4 PE=2 SV=1 250 454 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 127 149 22
2 156 178 22
3 188 210 22
4 245 267 22
5 271 293 22
6 366 388 22
7 403 423 20
8 436 458 22
9 487 509 22
10 522 541 19
11 551 573 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|436
MASAVTIDHDAITPAAGLMEHKPAKDKEMVVSKASVAGVASLHSAQDDYEGRPTDEEMHTLRRVSGKIMWSMWTI
AFVELCERFSYYGTSVLYTNFINHPLPPGSRTGAPVHAGDLPGALGMGPKAAQGLTLFNMFFAYLMPLLGAWVAD
ARMGRFWTLHLAIGISTIAHVILVVAASPGVLANNKASFGVFIVGLLVLCVGTGFFKANVSPLLAEQNDDVRPRV
EVRPDGERVIVDPAVTNTRIFLYFYFCINVGSLTGQIGMVYVEKYVGFWVAFLIPTALFLLAPFVLGSQKKSYKL
KPPTGSLLSKFFRMFLYVRRRSGLTGFDWSVAKPSNVPVGQRPSWMTYDDAWVDEVRRGLKACKVFLFLPIFFLS
YNQMTGNLTIQAGTMELHGVPNDIIQNLNPISILIIIPVFDHLLYPFLRKMGFAFTPIKRMTTGFIIAALSMVAS
AVMQYYIYQKSPCGWYANKTVVVDGAERQCPPAPINVWAQCLPYIFIGIAEVLANVTSYEYAFSKAPENMKSLVM
SVNLFMSAISAAIGQAFTPLSGDPLLVWNYTVVAVIAFIGGVAFWFCFSHLDSEEDKLNMLKKSDFIGQQKPGLT
KAQEAGEDV*
Coding >Ophun1|436
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCGCCGGCCTCATGGAGCACAAGCCAGCCAAA
GACAAAGAAATGGTCGTCTCCAAGGCGTCCGTCGCGGGCGTCGCCTCCCTCCACAGCGCCCAAGACGACTACGAA
GGCCGGCCAACCGACGAGGAGATGCACACGCTTCGCCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACCATT
GCCTTTGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCATCCG
CTTCCGCCGGGGTCGCGGACCGGAGCCCCCGTTCATGCCGGCGATTTGCCCGGCGCTCTCGGCATGGGGCCCAAG
GCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGCTGGGCGCCTGGGTCGCCGAC
GCCCGCATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCCACCATCGCCCACGTTATCCTCGTCGTC
GCCGCCTCCCCCGGCGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGCCTGCTGGTCCTCTGC
GTCGGAACCGGCTTCTTCAAAGCAAACGTCTCCCCCTTACTGGCCGAGCAAAACGACGATGTCCGCCCCCGCGTC
GAGGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACCCGCATCTTCCTCTACTTTTAC
TTTTGCATCAATGTCGGCTCTTTGACGGGGCAGATTGGCATGGTCTACGTTGAGAAATACGTGGGCTTCTGGGTT
GCTTTCTTGATTCCTACCGCTCTCTTCCTGCTGGCGCCCTTCGTGCTGGGCTCGCAGAAGAAGAGCTACAAGCTG
AAGCCACCGACAGGCTCACTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGCTCTGGCCTCACC
GGCTTCGACTGGAGCGTCGCCAAGCCTTCCAACGTCCCCGTCGGTCAACGACCCTCCTGGATGACCTACGACGAT
GCCTGGGTCGACGAGGTTCGCCGTGGCCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTCTCC
TACAACCAGATGACGGGCAACCTCACCATCCAGGCCGGAACCATGGAGCTGCACGGCGTGCCCAACGACATCATC
CAGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGACCACCTCCTCTACCCGTTCCTGCGCAAG
ATGGGCTTCGCCTTCACCCCCATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCCTCG
GCCGTCATGCAGTACTATATATACCAAAAGAGCCCCTGCGGCTGGTACGCCAACAAGACCGTCGTCGTCGATGGC
GCCGAGAGGCAGTGTCCGCCCGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATAGCC
GAGGTGCTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTCATG
AGCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCCTGTCCGGCGATCCCCTC
CTGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTTATCGGCGGCGTCGCCTTTTGGTTCTGCTTCAGCCAC
CTCGATTCTGAAGAGGACAAGCTCAACATGCTCAAAAAGTCCGACTTTATCGGTCAACAGAAACCAGGCCTGACC
AAGGCTCAGGAAGCGGGCGAAGACGTATGA
Transcript >Ophun1|436
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCGCCGGCCTCATGGAGCACAAGCCAGCCAAA
GACAAAGAAATGGTCGTCTCCAAGGCGTCCGTCGCGGGCGTCGCCTCCCTCCACAGCGCCCAAGACGACTACGAA
GGCCGGCCAACCGACGAGGAGATGCACACGCTTCGCCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACCATT
GCCTTTGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCATCCG
CTTCCGCCGGGGTCGCGGACCGGAGCCCCCGTTCATGCCGGCGATTTGCCCGGCGCTCTCGGCATGGGGCCCAAG
GCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGCTGGGCGCCTGGGTCGCCGAC
GCCCGCATGGGCCGCTTCTGGACCCTCCACCTCGCAATCGGCATCTCCACCATCGCCCACGTTATCCTCGTCGTC
GCCGCCTCCCCCGGCGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGCCTGCTGGTCCTCTGC
GTCGGAACCGGCTTCTTCAAAGCAAACGTCTCCCCCTTACTGGCCGAGCAAAACGACGATGTCCGCCCCCGCGTC
GAGGTCCGTCCCGATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACCCGCATCTTCCTCTACTTTTAC
TTTTGCATCAATGTCGGCTCTTTGACGGGGCAGATTGGCATGGTCTACGTTGAGAAATACGTGGGCTTCTGGGTT
GCTTTCTTGATTCCTACCGCTCTCTTCCTGCTGGCGCCCTTCGTGCTGGGCTCGCAGAAGAAGAGCTACAAGCTG
AAGCCACCGACAGGCTCACTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGCTCTGGCCTCACC
GGCTTCGACTGGAGCGTCGCCAAGCCTTCCAACGTCCCCGTCGGTCAACGACCCTCCTGGATGACCTACGACGAT
GCCTGGGTCGACGAGGTTCGCCGTGGCCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTCTCC
TACAACCAGATGACGGGCAACCTCACCATCCAGGCCGGAACCATGGAGCTGCACGGCGTGCCCAACGACATCATC
CAGAACCTCAACCCCATCTCCATCCTCATCATCATCCCCGTCTTCGACCACCTCCTCTACCCGTTCCTGCGCAAG
ATGGGCTTCGCCTTCACCCCCATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCCTCG
GCCGTCATGCAGTACTATATATACCAAAAGAGCCCCTGCGGCTGGTACGCCAACAAGACCGTCGTCGTCGATGGC
GCCGAGAGGCAGTGTCCGCCCGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATAGCC
GAGGTGCTGGCCAACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTCATG
AGCGTCAACCTCTTCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCCTGTCCGGCGATCCCCTC
CTGGTCTGGAACTACACCGTCGTGGCCGTCATTGCCTTTATCGGCGGCGTCGCCTTTTGGTTCTGCTTCAGCCAC
CTCGATTCTGAAGAGGACAAGCTCAACATGCTCAAAAAGTCCGACTTTATCGGTCAACAGAAACCAGGCCTGACC
AAGGCTCAGGAAGCGGGCGAAGACGTATGA
Gene >Ophun1|436
ATGGCGAGCGCCGTCACCATCGACCACGATGCCATCACACCCGCCGCCGGCCTCATGGAGCACAAGCCAGCCAAA
GACAAAGAAATGGTCGTCTCCAAGGCGTCCGTCGCGGGCGTCGCCTCCCTCCACAGCGCCCAAGACGACTACGAA
GGCCGGCCAACCGACGAGGAGATGCACACGCTTCGCCGCGTCTCGGGCAAGATCATGTGGAGCATGTGGACCATT
GCCTTTGTCGAGCTGTGCGAGCGCTTCTCCTACTACGGCACTTCGGTTCTCTACACCAACTTCATCAACCATCCG
CTTCCGCCGGGGTCGCGGACCGGAGCCCCCGTTCATGCCGGCGATTTGCCCGGCGCTCTCGGCATGGGGCCCAAG
GCGGCGCAGGGGCTGACGCTGTTTAACATGTTTTTCGCCTATCTGATGCCGCTGCTGGGGTGAGTTGGCTGTATA
CGACTTGGGTTGCTGTTGTCATCCTTGTTATCCCTGTTTGTTGTTGCTATCCTCAACTCCTTCACAACCAACCAA
CCAACCCTCAACAACCCCATCGCTAACCTCTCCCACCTCTCTCCAGCGCCTGGGTCGCCGACGCCCGCATGGGCC
GCTTCTGGACCCTCCACCTCGCAATCGGCATCTCCACCATCGCCCACGTTATCCTCGTCGTCGCCGCCTCCCCCG
GCGTCCTGGCCAACAACAAGGCCTCCTTCGGCGTCTTCATCGTCGGCCTGCTGGTCCTCTGCGTCGGAACCGGCT
TCTTCAAAGCAAACGTCTCCCCCTTACTGGCCGAGCAAAACGACGATGTCCGCCCCCGCGTCGAGGTCCGTCCCG
ATGGCGAGCGCGTCATCGTCGACCCGGCCGTTACCAATACCCGCATCTTCCTCTACTTTTACTTTTGCATCAATG
TCGGCTCTTTGACGGGGCAGATTGGCATGGTCTACGTTGAGAAATACGTGGGCTTCTGGGTTGCTTTCTTGATTC
CTACCGCTCTCTTCCTGCTGGCGCCCTTCGTGCTGGGCTCGCAGAAGAAGAGCTACAAGCTGAAGCCACCGACAG
GCTCACTGCTGTCCAAGTTCTTCCGCATGTTCCTCTACGTCCGGCGCCGCTCTGGCCTCACCGGCTTCGACTGGA
GCGTCGCCAAGCCTTCCAACGTCCCCGTCGGTCAACGACCCTCCTGGATGACCTACGACGATGCCTGGGTCGACG
AGGTTCGCCGTGGCCTCAAGGCCTGCAAGGTCTTCCTCTTCCTGCCCATCTTCTTCCTCTCCTACAACCAGATGA
CGGGCAACCTCACCATCCAGGCCGGAACCATGGAGCTGCACGGCGTGCCCAACGACATCATCCAGAACCTCAACC
CCATCTCCATCCTCATCATCATCCCCGTCTTCGACCACCTCCTCTACCCGTTCCTGCGCAAGATGGGCTTCGCCT
TCACCCCCATCAAGCGCATGACGACGGGCTTCATCATCGCCGCCCTCTCCATGGTCGCCTCGGCCGTCATGCAGT
ACTATATATACCAAAAGAGCCCCTGCGGCTGGTACGCCAACAAGACCGTCGTCGTCGATGGCGCCGAGAGGCAGT
GTCCGCCCGCGCCCATCAACGTCTGGGCCCAGTGTCTGCCCTACATCTTCATCGGCATAGCCGAGGTGCTGGCCA
ACGTCACCTCGTACGAGTATGCCTTCTCCAAGGCGCCCGAGAACATGAAGTCTCTCGTCATGAGCGTCAACCTCT
TCATGAGCGCCATCTCCGCCGCCATCGGCCAGGCCTTTACCCCCCTGTCCGGCGATCCCCTCCTGGTCTGGAACT
ACACCGTCGTGGCCGTCATTGCCTTTATCGGCGGCGTCGCCTTTTGGTTCTGCTTCAGCCACCTCGATTCTGAAG
AGGACAAGCTCAACATGCTCAAAAAGTCCGACTTTATCGGTCAACAGAAACCAGGCCTGACCAAGGCTCAGGAAG
CGGGCGAAGACGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail