Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4359
Gene name
LocationContig_40:25979..27114
Strand-
Gene length (bp)1135
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 2.7E-18 91 208
PF13489 Methyltransf_23 Methyltransferase domain 5.5E-18 77 255
PF13649 Methyltransf_25 Methyltransferase domain 7.1E-16 90 204
PF08242 Methyltransf_12 Methyltransferase domain 1.4E-14 91 206
PF02353 CMAS Mycolic acid cyclopropane synthetase 3.3E-13 31 216
PF13847 Methyltransf_31 Methyltransferase domain 1.5E-13 86 223
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.7E-06 84 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 28 323 3.0E-32
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 26 322 9.0E-31
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 47 216 1.0E-25
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 31 322 8.0E-23
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 33 290 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 28 323 3.0E-32
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 26 322 9.0E-31
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 47 216 1.0E-25
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 31 322 8.0E-23
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 33 290 6.0E-20
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 33 290 6.0E-20
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 23 270 3.0E-18
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 12 258 6.0E-17
sp|Q9KJ21|SDMT_HALHR Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 33 253 2.0E-16
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 25 258 3.0E-16
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 34 220 3.0E-15
sp|Q54I98|SMT1_DICDI Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 32 275 6.0E-15
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 32 291 8.0E-15
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 25 255 2.0E-14
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 26 258 3.0E-14
sp|Q875K1|ERG6_CLAL4 Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 33 281 4.0E-14
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 13 272 4.0E-14
sp|P25087|ERG6_YEAST Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 35 218 1.0E-13
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 35 266 2.0E-13
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 33 253 2.0E-13
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 35 218 2.0E-13
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 39 240 2.0E-13
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 34 241 1.0E-12
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 35 218 2.0E-12
sp|Q83WC3|SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 26 258 6.0E-12
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 83 243 6.0E-11
sp|H2E7T9|SMTL2_BOTBR Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 32 224 4.0E-10
sp|H2E7T7|BOMT_BOTBR Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 36 220 5.0E-10
sp|Q7U4Z9|SDMT_SYNPX Dimethylglycine N-methyltransferase OS=Synechococcus sp. (strain WH8102) GN=bsmB PE=1 SV=1 43 253 5.0E-10
sp|H2E7T5|SQMT1_BOTBR Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 36 224 8.0E-10
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 33 238 1.0E-09
sp|H2E7T6|SQMT2_BOTBR Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 36 224 1.0E-09
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 32 224 1.0E-09
sp|Q47GP8|UBIG_DECAR Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 39 209 2.0E-09
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 72 209 4.0E-09
sp|Q02PX7|UBIG_PSEAB Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiG PE=3 SV=1 90 209 7.0E-09
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 72 209 1.0E-08
sp|Q1QEI9|UBIG_PSYCK Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=ubiG PE=3 SV=2 49 209 2.0E-08
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 72 209 2.0E-08
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 72 209 2.0E-08
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 72 209 2.0E-08
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 69 214 3.0E-08
sp|A6V2Q4|UBIG_PSEA7 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiG PE=3 SV=1 89 209 3.0E-08
sp|B7V9J5|UBIG_PSEA8 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiG PE=3 SV=1 90 209 4.0E-08
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 69 214 4.0E-08
sp|Q9HZ63|UBIG_PSEAE Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiG PE=3 SV=1 90 209 4.0E-08
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 69 227 8.0E-08
sp|Q4FVG3|UBIG_PSYA2 Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiG PE=3 SV=2 65 209 1.0E-07
sp|Q1IDA6|UBIG_PSEE4 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 90 301 3.0E-07
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 33 125 3.0E-07
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 33 125 3.0E-07
sp|Q88M10|UBIG_PSEPK Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiG PE=3 SV=1 90 301 6.0E-07
sp|A5W7G3|UBIG_PSEP1 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiG PE=3 SV=1 90 301 6.0E-07
sp|B0KTX4|UBIG_PSEPG Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=ubiG PE=3 SV=1 90 301 7.0E-07
sp|Q87ND5|UBIG_VIBPA Ubiquinone biosynthesis O-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiG PE=3 SV=1 90 209 7.0E-07
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 48 215 1.0E-06
sp|Q9CD86|PHMT_MYCLE Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium leprae (strain TN) GN=ML0130 PE=3 SV=1 62 210 1.0E-06
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 32 133 2.0E-06
sp|Q4ZQ90|UBIG_PSEU2 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiG PE=3 SV=1 90 279 2.0E-06
sp|Q48FM4|UBIG_PSE14 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiG PE=3 SV=1 90 279 2.0E-06
sp|A1TSA0|UBIG_ACIAC Ubiquinone biosynthesis O-methyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ubiG PE=3 SV=1 89 204 2.0E-06
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 90 214 3.0E-06
sp|A7MU79|UBIG_VIBCB Ubiquinone biosynthesis O-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiG PE=3 SV=1 90 209 3.0E-06
sp|A4FG18|GPPMT_SACEN Geranyl diphosphate 2-C-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_3721 PE=1 SV=1 50 207 4.0E-06
sp|B2JEZ6|UBIG_BURP8 Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiG PE=3 SV=1 53 204 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4359
MSVPESSTPLSRQYEMQLGQPHEEMEALKGKIKQHYDIASDSYLDIWGEHIHHGYWPTPESEANDSKETAELNLV
KLLLSISKLETNANVLDVGCGVGGSARHLASQLGCNVTGITISTRQVELAYKLSKAEAGSAAESAVDDNSVRLGS
GKVRFLEMDAETMADHFGGEAGTFDVVWIVEALSHFPNKTLFFENAYRVLRPGGKLVLADWFKADELDAEALRNE
IKPIEDGMLLPPLCTQTDYVHLAKTAGLGVFAEPIDISKQVRKTWDLTWSMIQKPSLWQFALSHGRDALAFLQSF
RAMRSGYYKGSFRYAVMTFQKPEA*
Coding >Ophun1|4359
ATGTCCGTCCCTGAAAGCAGCACGCCGCTCAGCAGGCAGTATGAGATGCAGCTGGGACAGCCACACGAAGAGATG
GAGGCTCTCAAGGGCAAGATCAAGCAGCACTACGACATTGCCAGCGATAGCTATCTCGACATCTGGGGCGAGCAC
ATCCATCATGGTTACTGGCCGACACCGGAGTCGGAAGCCAACGACAGCAAGGAGACGGCCGAGCTGAACCTCGTC
AAGCTCCTCCTCTCCATCTCCAAGCTCGAGACCAACGCCAACGTCCTCGACGTCGGCTGCGGCGTGGGTGGTTCA
GCCCGTCATCTCGCCTCCCAGCTCGGCTGCAACGTAACGGGCATCACCATCTCGACCCGACAAGTCGAGCTAGCC
TATAAACTCTCAAAAGCCGAGGCCGGAAGCGCCGCCGAGTCTGCGGTCGACGACAACTCGGTCCGTCTGGGCTCC
GGCAAGGTCCGCTTCCTCGAGATGGACGCCGAGACCATGGCAGATCACTTTGGCGGCGAGGCGGGCACCTTTGAC
GTCGTCTGGATCGTCGAGGCTCTCAGTCACTTTCCCAACAAGACGCTGTTCTTTGAGAATGCGTATCGGGTGCTT
CGGCCTGGCGGGAAGCTCGTCCTGGCCGACTGGTTCAAGGCCGATGAGCTGGATGCCGAGGCGCTGCGGAACGAG
ATAAAGCCCATTGAAGACGGCATGCTTCTTCCGCCTCTCTGCACGCAAACGGACTATGTCCATCTGGCCAAAACG
GCAGGGCTGGGCGTCTTTGCCGAGCCCATCGACATCAGTAAACAAGTCCGCAAGACGTGGGACTTGACCTGGTCG
ATGATCCAGAAGCCGTCCCTCTGGCAGTTTGCGCTCTCGCACGGCAGAGATGCCCTGGCCTTTCTCCAGAGCTTC
CGGGCCATGCGCAGTGGCTACTACAAGGGGAGCTTCCGGTATGCCGTCATGACGTTTCAGAAGCCGGAGGCGTAG
Transcript >Ophun1|4359
ATGTCCGTCCCTGAAAGCAGCACGCCGCTCAGCAGGCAGTATGAGATGCAGCTGGGACAGCCACACGAAGAGATG
GAGGCTCTCAAGGGCAAGATCAAGCAGCACTACGACATTGCCAGCGATAGCTATCTCGACATCTGGGGCGAGCAC
ATCCATCATGGTTACTGGCCGACACCGGAGTCGGAAGCCAACGACAGCAAGGAGACGGCCGAGCTGAACCTCGTC
AAGCTCCTCCTCTCCATCTCCAAGCTCGAGACCAACGCCAACGTCCTCGACGTCGGCTGCGGCGTGGGTGGTTCA
GCCCGTCATCTCGCCTCCCAGCTCGGCTGCAACGTAACGGGCATCACCATCTCGACCCGACAAGTCGAGCTAGCC
TATAAACTCTCAAAAGCCGAGGCCGGAAGCGCCGCCGAGTCTGCGGTCGACGACAACTCGGTCCGTCTGGGCTCC
GGCAAGGTCCGCTTCCTCGAGATGGACGCCGAGACCATGGCAGATCACTTTGGCGGCGAGGCGGGCACCTTTGAC
GTCGTCTGGATCGTCGAGGCTCTCAGTCACTTTCCCAACAAGACGCTGTTCTTTGAGAATGCGTATCGGGTGCTT
CGGCCTGGCGGGAAGCTCGTCCTGGCCGACTGGTTCAAGGCCGATGAGCTGGATGCCGAGGCGCTGCGGAACGAG
ATAAAGCCCATTGAAGACGGCATGCTTCTTCCGCCTCTCTGCACGCAAACGGACTATGTCCATCTGGCCAAAACG
GCAGGGCTGGGCGTCTTTGCCGAGCCCATCGACATCAGTAAACAAGTCCGCAAGACGTGGGACTTGACCTGGTCG
ATGATCCAGAAGCCGTCCCTCTGGCAGTTTGCGCTCTCGCACGGCAGAGATGCCCTGGCCTTTCTCCAGAGCTTC
CGGGCCATGCGCAGTGGCTACTACAAGGGGAGCTTCCGGTATGCCGTCATGACGTTTCAGAAGCCGGAGGCGTAG
Gene >Ophun1|4359
ATGTCCGTCCCTGAAAGCAGCACGCCGCTCAGCAGGCAGTATGAGATGCAGCTGGGACAGCCACACGAAGAGATG
GAGGCTCTCAAGGGCAAGATCAAGCAGCACTACGACATTGCCAGCGATAGCTATCTCGACATCTGGTAAGTAAGT
TGCGGGCATCAGAAGGCAGCACGAGGCTCTGATAGACATTCAGGGGCGAGCACATCCATCATGGTTACTGGCCGA
CACCGGAGTCGGAAGCCAACGACAGCAAGGAGACGGCCGAGCTGAACCTCGTCAAGCTCCTCCTCTCCATCTCCA
AGCTCGAGACCAACGCCAACGTCCTCGACGTCGGCTGCGGCGTGGGTGGTTCAGCCCGTCATCTCGCCTCCCAGC
TCGGCTGCAACGTAACGGGCATCACCATCTCGACCCGACAAGTCGAGCTAGCCTATAAACTCTCAAAAGCCGAGG
CCGGAAGCGCCGCCGAGTCTGCGGTCGACGACAACTCGGTCCGTCTGGGCTCCGGCAAGGTCCGCTTCCTCGAGA
TGGACGCCGAGACCATGGCAGATCACTTTGGCGGCGAGGCGGGCACCTTTGACGTCGTCTGGATCGTCGAGGCTC
TCAGTCACTTTCCCAACAAGACGCTGTTCTTTGAGAATGCGTATCGGGTGCTTCGGCCTGGCGGGAAGCTCGTCC
TGGCCGACTGGTTCAAGGCCGATGAGCTGGATGCCGAGGCGCTGCGGAACGAGATAAAGCCCATTGAAGGTAAGT
TGGTAGTTGGCTGTGAGGAGGCTGTTTGCTCATCATCTTAGACGGCATGCTTCTTCCGCCTCTCTGCACGCAAAC
GGACTATGTCCATCTGGCCAAAACGGCAGGGCTGGGCGTCTTTGCCGAGCCCATCGACATCAGTAAACAAGTCCG
CAAGACGTGGTGAGTGGCGACGAGTCTTTTACAGTCACGCCGTGTTTGTTGTCTGACGCTGCGATACAGGGACTT
GACCTGGTCGATGATCCAGAAGCCGTCCCTCTGGCAGTTTGCGCTCTCGCACGGCAGAGATGCCCTGGCCTTTCT
CCAGAGCTTCCGGGCCATGCGCAGTGGCTACTACAAGGGGAGCTTCCGGTATGCCGTCATGACGTTTCAGAAGCC
GGAGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail