Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4358
Gene name
LocationContig_40:23130..25868
Strand+
Gene length (bp)2738
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.2E-38 40 460

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 39 469 1.0E-47
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 39 470 6.0E-47
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 8 474 1.0E-46
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 32 469 3.0E-41
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 14 477 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 39 469 1.0E-47
sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 39 470 6.0E-47
sp|Q9SMP5|C94B3_ARATH Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 8 474 1.0E-46
sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 32 469 3.0E-41
sp|Q9FMV7|C94B1_ARATH Cytochrome P450 94B1 OS=Arabidopsis thaliana GN=CYP94B1 PE=2 SV=1 14 477 1.0E-40
sp|Q9ZUX1|C94C1_ARATH Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 62 469 6.0E-40
sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 37 469 1.0E-39
sp|Q9FVS9|C96AF_ARATH Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 18 467 6.0E-36
sp|Q9LMM1|C86A4_ARATH Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 40 469 7.0E-35
sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 40 486 4.0E-34
sp|Q9C788|C70B1_ARATH Cytochrome P450 704B1 OS=Arabidopsis thaliana GN=CYP704B1 PE=1 SV=1 31 428 2.0E-33
sp|O80823|C86A8_ARATH Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 40 481 2.0E-32
sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 86 469 2.0E-31
sp|B3RFJ6|86A22_PETHY Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 40 465 8.0E-31
sp|Q9CAD6|C86A7_ARATH Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 40 472 2.0E-30
sp|Q12581|CP52X_CANMA Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 117 446 1.0E-24
sp|D4AY62|A1131_ARTBC Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 250 423 1.0E-23
sp|Q82IY3|PTLI_STRAW Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 40 442 1.0E-23
sp|P30608|CP52F_CANTR Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 117 435 4.0E-23
sp|P10615|CP52A_CANTR Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 98 469 2.0E-22
sp|P43083|CP52V_CANAP Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 117 469 3.0E-22
sp|P24458|CP52E_CANMA Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 117 434 8.0E-22
sp|P16496|CP52C_CANMA Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 117 434 8.0E-21
sp|Q12573|CP52W_CANAP Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 117 435 1.0E-20
sp|P78329|CP4F2_HUMAN Phylloquinone omega-hydroxylase CYP4F2 OS=Homo sapiens GN=CYP4F2 PE=1 SV=1 102 470 2.0E-20
sp|P16141|CP52D_CANMA Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 98 469 7.0E-20
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 57 444 1.0E-19
sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 117 439 2.0E-19
sp|Q9Y757|CP52L_DEBHN Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 278 469 2.0E-19
sp|P85191|CP450_HELAN Cytochrome P450 (Fragment) OS=Helianthus annuus PE=1 SV=1 328 465 2.0E-19
sp|Q08477|CP4F3_HUMAN Docosahexaenoic acid omega-hydroxylase CYP4F3 OS=Homo sapiens GN=CYP4F3 PE=1 SV=2 97 470 3.0E-19
sp|Q12586|CP52I_CANMA Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 98 470 4.0E-19
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 38 442 1.0E-18
sp|Q12588|CP52J_CANMA Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 117 470 1.0E-18
sp|Q9LUC9|C7A11_ARATH Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 57 445 1.0E-18
sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 117 435 2.0E-18
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 7 484 3.0E-18
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 106 461 4.0E-18
sp|Q12589|CP52K_CANMA Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 117 470 8.0E-18
sp|Q12585|CP52T_CANMA Cytochrome P450 52D1 OS=Candida maltosa GN=CYP52D1 PE=2 SV=1 117 469 1.0E-17
sp|P30610|CP52H_CANTR Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 117 470 1.0E-17
sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 40 438 3.0E-17
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 280 450 3.0E-17
sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 117 485 4.0E-17
sp|B9GBJ9|C14C1_ORYSJ Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 106 461 5.0E-17
sp|Q9LUC8|C7A13_ARATH Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 57 445 5.0E-17
sp|Q6TBX7|LUT1_ARATH Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 86 469 5.0E-17
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 280 439 7.0E-17
sp|P51869|CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 106 470 8.0E-17
sp|Q9EP75|CP4FE_MOUSE Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 80 470 1.0E-16
sp|Q9V4T5|CP4E1_DROME Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 7 481 1.0E-16
sp|Q9HCS2|CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 80 470 2.0E-16
sp|P9WPM1|CP139_MYCTU Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp139 PE=1 SV=1 170 437 3.0E-16
sp|P9WPM0|CP139_MYCTO Putative cytochrome P450 139 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp139 PE=3 SV=1 170 437 3.0E-16
sp|P63720|CP139_MYCBO Putative cytochrome P450 139 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp139 PE=3 SV=1 170 437 3.0E-16
sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 204 470 3.0E-16
sp|Q9LUC5|C7A15_ARATH Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 86 445 4.0E-16
sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 86 442 6.0E-16
sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 282 441 8.0E-16
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 80 470 8.0E-16
sp|Q9HBI6|CP4FB_HUMAN Phylloquinone omega-hydroxylase CYP4F11 OS=Homo sapiens GN=CYP4F11 PE=1 SV=3 280 470 1.0E-15
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 223 441 1.0E-15
sp|P98187|CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 238 438 1.0E-15
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 117 441 1.0E-15
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 40 444 2.0E-15
sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 8 470 2.0E-15
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 233 442 2.0E-15
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 246 450 2.0E-15
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 1 444 5.0E-15
sp|O15528|CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 234 458 7.0E-15
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 117 441 7.0E-15
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 4 423 9.0E-15
sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 280 470 1.0E-14
sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 57 444 1.0E-14
sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 40 442 1.0E-14
sp|Q9T093|C70B3_ARATH Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 57 444 2.0E-14
sp|Q9VYQ7|CP311_DROME Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 40 423 2.0E-14
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 40 444 2.0E-14
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 254 454 2.0E-14
sp|P33274|CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus GN=Cyp4f1 PE=2 SV=1 80 470 2.0E-14
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 9 426 2.0E-14
sp|O88833|CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=2 283 442 3.0E-14
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 21 495 3.0E-14
sp|P30611|CP52N_CANTR Cytochrome P450 52B1 OS=Candida tropicalis GN=CYP52B1 PE=2 SV=1 119 434 3.0E-14
sp|P9WPM5|CP137_MYCTU Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 273 463 3.0E-14
sp|P9WPM4|CP137_MYCTO Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 273 463 3.0E-14
sp|Q12587|CP52Q_CANMA Cytochrome P450 52C2 OS=Candida maltosa GN=CYP52C2 PE=2 SV=1 115 435 3.0E-14
sp|F4IK45|C70B2_ARATH Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 57 470 3.0E-14
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 106 444 4.0E-14
sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 118 470 4.0E-14
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 254 440 4.0E-14
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 275 442 4.0E-14
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 36 459 5.0E-14
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 246 441 5.0E-14
sp|P08516|CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2 283 442 5.0E-14
sp|P14581|CP4A7_RABIT Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1 282 473 7.0E-14
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 281 455 7.0E-14
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 234 460 7.0E-14
sp|Q2QYH7|C14C2_ORYSJ Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 117 423 7.0E-14
sp|Q9VFJ0|CA131_DROME Probable cytochrome P450 313a1 OS=Drosophila melanogaster GN=Cyp313a1 PE=3 SV=2 38 423 8.0E-14
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 247 441 8.0E-14
sp|H2DH17|C7A22_PANGI Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 114 444 8.0E-14
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 275 459 8.0E-14
sp|P20817|CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2 282 442 9.0E-14
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 86 444 1.0E-13
sp|Q8SPK0|CP4AP_PIG Cytochrome P450 4A25 OS=Sus scrofa GN=CYP4A25 PE=2 SV=1 282 442 1.0E-13
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 280 486 1.0E-13
sp|P15129|CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus GN=Cyp4b1 PE=1 SV=3 101 443 1.0E-13
sp|Q02318|CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 254 465 1.0E-13
sp|P14580|CP4A6_RABIT Cytochrome P450 4A6 OS=Oryctolagus cuniculus GN=CYP4A6 PE=1 SV=1 282 469 1.0E-13
sp|Q91WL5|CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=1 SV=2 283 442 1.0E-13
sp|P79716|CP1A1_DICLA Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 36 441 2.0E-13
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 267 484 2.0E-13
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 40 444 2.0E-13
sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 276 441 2.0E-13
sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 36 469 2.0E-13
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 275 444 2.0E-13
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 286 441 2.0E-13
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 276 475 3.0E-13
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 40 444 3.0E-13
sp|Q9GJX5|CP4AL_PIG Taurochenodeoxycholic 6 alpha-hydroxylase OS=Sus scrofa GN=CYP4A21 PE=1 SV=1 282 442 3.0E-13
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 246 441 3.0E-13
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 253 489 3.0E-13
sp|Q6A152|CP4X1_MOUSE Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 118 465 3.0E-13
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 32 440 4.0E-13
sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 282 440 4.0E-13
sp|Q9VG40|CP134_DROME Probable cytochrome P450 313a4 OS=Drosophila melanogaster GN=Cyp313a4 PE=2 SV=4 236 447 4.0E-13
sp|Q8SPK1|CP4AO_PIG Cytochrome P450 4A24 OS=Sus scrofa GN=CYP4A24 PE=2 SV=1 282 469 5.0E-13
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 267 440 5.0E-13
sp|P14579|CP4A5_RABIT Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1 282 442 5.0E-13
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 221 460 6.0E-13
sp|P20816|CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2 282 442 6.0E-13
sp|Q9V7G5|C4AA1_DROME Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 109 475 7.0E-13
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 275 486 8.0E-13
sp|Q16678|CP1B1_HUMAN Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 282 459 8.0E-13
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 22 441 9.0E-13
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 282 459 9.0E-13
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 17 444 9.0E-13
sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 97 469 1.0E-12
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 268 486 1.0E-12
sp|P17177|CP27A_RABIT Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 251 465 1.0E-12
sp|Q29497|CP17A_SHEEP Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 7 441 1.0E-12
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 28 460 1.0E-12
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 86 469 1.0E-12
sp|P10611|CP4A4_RABIT Cytochrome P450 4A4 OS=Oryctolagus cuniculus GN=CYP4A4 PE=1 SV=3 282 442 1.0E-12
sp|P15128|CP4B1_RABIT Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 101 435 1.0E-12
sp|Q64462|CP4B1_MOUSE Cytochrome P450 4B1 OS=Mus musculus GN=Cyp4b1 PE=1 SV=1 101 442 1.0E-12
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 234 442 1.0E-12
sp|Q8K4D6|CP4X1_RAT Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 106 423 2.0E-12
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 275 459 2.0E-12
sp|Q7KWN2|C525A_DICDI Probable cytochrome P450 525A1 OS=Dictyostelium discoideum GN=cyp525A1 PE=3 SV=1 262 440 2.0E-12
sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 260 445 2.0E-12
sp|Q86W10|CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 119 445 2.0E-12
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 22 441 2.0E-12
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 275 438 2.0E-12
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 253 439 2.0E-12
sp|O35728|CP4AE_MOUSE Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=1 SV=1 283 442 3.0E-12
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 7 441 3.0E-12
sp|O23365|C97B3_ARATH Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 41 469 3.0E-12
sp|Q00714|STCS_EMENI Probable sterigmatocystin biosynthesis P450 monooxygenase stcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcS PE=1 SV=2 275 444 3.0E-12
sp|Q5TCH4|CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens GN=CYP4A22 PE=1 SV=1 282 442 3.0E-12
sp|Q64678|CP1B1_RAT Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 250 441 4.0E-12
sp|Q02928|CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens GN=CYP4A11 PE=1 SV=1 282 442 4.0E-12
sp|O13820|ERG5_SCHPO Cytochrome P450 61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg5 PE=1 SV=3 245 452 4.0E-12
sp|Q6UEG2|AFLN_ASPPA P450 monooxygenase AflN OS=Aspergillus parasiticus GN=aflN PE=3 SV=1 283 444 4.0E-12
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 268 460 4.0E-12
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 286 441 5.0E-12
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 37 441 5.0E-12
sp|P13584|CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens GN=CYP4B1 PE=1 SV=2 275 443 5.0E-12
sp|Q6NKZ8|C14A2_ARATH Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 260 435 5.0E-12
sp|Q9ASR3|C7091_ARATH Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 57 469 5.0E-12
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 119 442 6.0E-12
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 27 435 7.0E-12
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 106 444 7.0E-12
sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 273 438 7.0E-12
sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 272 474 8.0E-12
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 275 486 8.0E-12
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 284 448 1.0E-11
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 41 469 1.0E-11
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 273 486 1.0E-11
sp|Q9V557|CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 23 469 1.0E-11
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 281 441 1.0E-11
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 34 440 1.0E-11
sp|P30612|CP52P_CANTR Cytochrome P450 52C1 OS=Candida tropicalis GN=CYP52C1 PE=2 SV=1 276 435 1.0E-11
sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 115 471 2.0E-11
sp|Q7XHW5|C14B1_ORYSJ Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 106 445 2.0E-11
sp|Q27515|C13A6_CAEEL Putative cytochrome P450 CYP13A6 OS=Caenorhabditis elegans GN=cyp-13A6 PE=3 SV=1 283 447 2.0E-11
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 27 435 2.0E-11
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 276 438 2.0E-11
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 267 488 2.0E-11
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 273 438 2.0E-11
sp|P33270|CP6A2_DROME Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 68 470 2.0E-11
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 30 441 2.0E-11
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 251 435 2.0E-11
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 36 438 2.0E-11
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 90 424 2.0E-11
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 281 441 2.0E-11
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 43 440 3.0E-11
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 281 441 3.0E-11
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 90 435 3.0E-11
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 17 444 3.0E-11
sp|Q9VHP4|CP313_DROME Probable cytochrome P450 313b1 OS=Drosophila melanogaster GN=Cyp313b1 PE=2 SV=2 38 472 3.0E-11
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 23 440 3.0E-11
sp|Q1ZXA4|C508D_DICDI Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 40 459 3.0E-11
sp|Q09653|C13AA_CAEEL Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 276 423 3.0E-11
sp|P24464|CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2 282 442 4.0E-11
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 275 440 4.0E-11
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 283 460 4.0E-11
sp|O08336|CYPB_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 2 OS=Bacillus subtilis (strain 168) GN=cypB PE=1 SV=1 281 470 4.0E-11
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 40 444 5.0E-11
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 281 439 6.0E-11
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 286 459 7.0E-11
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 275 460 7.0E-11
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 286 441 7.0E-11
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 40 447 8.0E-11
sp|Q55EK2|C524A_DICDI Probable cytochrome P450 524A1 OS=Dictyostelium discoideum GN=cyp524A1 PE=3 SV=1 281 434 8.0E-11
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 19 474 9.0E-11
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 42 441 9.0E-11
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 280 460 9.0E-11
sp|P14779|CPXB_BACME Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 281 463 1.0E-10
sp|Q27520|C13A1_CAEEL Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 283 460 1.0E-10
sp|P21595|CP56_YEAST Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 85 423 1.0E-10
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 34 474 1.0E-10
sp|O17624|C13B1_CAEEL Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=3 SV=2 276 448 1.0E-10
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 251 439 1.0E-10
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 281 489 1.0E-10
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 261 467 1.0E-10
sp|O42563|CP3AR_ONCMY Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 272 481 1.0E-10
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 280 459 2.0E-10
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 130 435 2.0E-10
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 100 457 3.0E-10
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 281 423 3.0E-10
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 31 442 3.0E-10
sp|Q27514|C13A5_CAEEL Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 283 460 3.0E-10
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 272 459 3.0E-10
sp|P04799|CP1A2_RAT Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 1 444 3.0E-10
sp|O44221|CP4E5_DROMT Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 43 466 3.0E-10
sp|Q6JZS3|CP1A1_ORYLA Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 275 459 4.0E-10
sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 36 469 4.0E-10
sp|Q9VGB5|CP135_DROME Probable cytochrome P450 313a5 OS=Drosophila melanogaster GN=Cyp313a5 PE=1 SV=2 234 468 4.0E-10
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 40 447 4.0E-10
sp|Q92110|CP1A1_ONCMY Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 36 438 4.0E-10
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 34 440 4.0E-10
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 280 441 4.0E-10
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 280 441 4.0E-10
sp|P38364|PID6_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDA6-1 PE=3 SV=1 284 441 4.0E-10
sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 274 445 4.0E-10
sp|P9WPN3|CP132_MYCTU Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 259 447 5.0E-10
sp|P9WPN2|CP132_MYCTO Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 259 447 5.0E-10
sp|P59954|CP132_MYCBO Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 259 447 5.0E-10
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 36 438 5.0E-10
sp|P30609|CP52G_CANTR Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 284 470 6.0E-10
sp|Q8N118|CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens GN=CYP4X1 PE=2 SV=1 106 435 6.0E-10
sp|Q92045|CP11A_DASAM Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 260 453 6.0E-10
sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 283 469 6.0E-10
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 13 439 7.0E-10
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 23 440 8.0E-10
sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 255 469 9.0E-10
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 221 453 1.0E-09
sp|Q9VGB3|CP133_DROME Probable cytochrome P450 313a3 OS=Drosophila melanogaster GN=Cyp313a3 PE=3 SV=2 40 465 1.0E-09
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 280 423 1.0E-09
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 286 459 1.0E-09
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 280 439 1.0E-09
sp|Q5UQ90|YL532_MIMIV Cytochrome P450-like protein L532 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L532 PE=1 SV=1 105 440 1.0E-09
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 275 472 1.0E-09
sp|Q964R0|CP6K1_BLAGE Cytochrome P450 6k1 OS=Blattella germanica GN=CYP6K1 PE=2 SV=1 40 467 2.0E-09
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 286 459 2.0E-09
sp|Q27756|CP6B3_PAPPO Cytochrome P450 6B3 OS=Papilio polyxenes GN=CYP6B3 PE=2 SV=1 273 469 2.0E-09
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 282 469 2.0E-09
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 286 459 2.0E-09
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 40 435 2.0E-09
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 272 459 2.0E-09
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 221 460 2.0E-09
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 22 419 2.0E-09
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 281 439 2.0E-09
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 40 444 2.0E-09
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 110 439 2.0E-09
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 35 441 3.0E-09
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 35 441 3.0E-09
sp|P79760|CP1A4_CHICK Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 282 440 3.0E-09
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 275 449 3.0E-09
sp|Q964R1|CP6J1_BLAGE Cytochrome P450 6j1 OS=Blattella germanica GN=CYP6J1 PE=2 SV=1 238 443 3.0E-09
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 35 441 3.0E-09
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 275 475 3.0E-09
sp|P90771|C36A1_CAEEL Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 9 439 3.0E-09
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 101 441 3.0E-09
sp|Q27518|C13A2_CAEEL Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 276 433 4.0E-09
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 273 444 4.0E-09
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 10 419 4.0E-09
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 280 423 5.0E-09
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 276 441 5.0E-09
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 19 449 5.0E-09
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 7 441 5.0E-09
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 279 440 5.0E-09
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 281 477 5.0E-09
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 130 443 5.0E-09
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 86 442 5.0E-09
sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 268 460 5.0E-09
sp|Q27698|CP6D1_MUSDO Cytochrome P450 6d1 OS=Musca domestica GN=CYP6D1 PE=1 SV=1 104 463 6.0E-09
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 284 441 6.0E-09
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 286 435 6.0E-09
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 269 460 6.0E-09
sp|Q43078|C97B1_PEA Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 41 423 6.0E-09
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 234 475 6.0E-09
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 253 435 6.0E-09
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 280 438 8.0E-09
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 276 460 8.0E-09
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 127 435 9.0E-09
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 100 442 9.0E-09
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 281 460 1.0E-08
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 127 439 1.0E-08
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 280 455 1.0E-08
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 286 459 1.0E-08
sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 332 469 1.0E-08
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 268 462 1.0E-08
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 268 462 1.0E-08
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 40 491 1.0E-08
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 130 442 1.0E-08
sp|Q9VYQ5|CP318_DROME Probable cytochrome P450 318a1 OS=Drosophila melanogaster GN=Cyp318a1 PE=2 SV=4 328 447 2.0E-08
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 257 423 2.0E-08
sp|O08394|CYPD_BACSU Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 229 449 2.0E-08
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 26 424 2.0E-08
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 130 462 2.0E-08
sp|Q92090|CP2K1_ONCMY Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 119 442 2.0E-08
sp|H2DH21|C7A29_PANGI Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1 117 444 2.0E-08
sp|Q9K498|EIZFM_STRCO Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 216 417 2.0E-08
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 1 425 2.0E-08
sp|Q27517|C13A3_CAEEL Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 283 468 2.0E-08
sp|Q27513|C13A4_CAEEL Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 283 460 2.0E-08
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 256 435 2.0E-08
sp|Q2XV99|CP11A_MACFA Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 260 448 3.0E-08
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 281 465 3.0E-08
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 281 465 3.0E-08
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 243 449 3.0E-08
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 234 471 3.0E-08
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 197 440 3.0E-08
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 95 419 3.0E-08
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 119 441 3.0E-08
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 248 419 3.0E-08
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 235 439 3.0E-08
sp|Q59990|CP120_SYNY3 Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cyp120 PE=1 SV=1 275 439 3.0E-08
sp|Q9W130|CP9C1_DROME Cytochrome P450 9c1 OS=Drosophila melanogaster GN=Cyp9c1 PE=2 SV=1 280 459 3.0E-08
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 13 442 3.0E-08
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 238 439 3.0E-08
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 127 435 3.0E-08
sp|A1DA60|FTMC_NEOFI Tryprostatin B 6-hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-1 PE=3 SV=1 280 441 4.0E-08
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 129 439 4.0E-08
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 282 441 4.0E-08
sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 283 442 4.0E-08
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 287 449 4.0E-08
sp|Q9VFP1|CP6D5_DROME Probable cytochrome P450 6d5 OS=Drosophila melanogaster GN=Cyp6d5 PE=2 SV=1 283 469 4.0E-08
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 269 442 5.0E-08
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 185 449 5.0E-08
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 281 450 5.0E-08
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 30 419 5.0E-08
sp|Q07217|CP11A_ONCMY Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 174 425 6.0E-08
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 22 419 6.0E-08
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 273 441 6.0E-08
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 286 459 6.0E-08
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 273 440 6.0E-08
sp|Q9V674|CP6G1_DROME Cytochrome P450 6g1 OS=Drosophila melanogaster GN=Cyp6g1 PE=2 SV=1 276 469 7.0E-08
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 264 486 7.0E-08
sp|Q2PG45|THAS_MACFA Thromboxane-A synthase OS=Macaca fascicularis GN=TBXAS1 PE=2 SV=2 276 423 7.0E-08
sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 262 460 8.0E-08
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 276 419 8.0E-08
sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 241 460 8.0E-08
sp|Q5KQH7|C14D1_ORYSJ Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 258 444 8.0E-08
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 281 492 9.0E-08
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 130 462 9.0E-08
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 130 442 1.0E-07
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 246 435 1.0E-07
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 281 439 1.0E-07
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 127 441 1.0E-07
sp|P24557|THAS_HUMAN Thromboxane-A synthase OS=Homo sapiens GN=TBXAS1 PE=1 SV=3 276 423 1.0E-07
sp|P05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 260 448 1.0E-07
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 100 442 1.0E-07
sp|P58047|C71AS_ARATH Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2 294 441 1.0E-07
sp|O64698|C7102_ARATH Cytochrome P450 710A2 OS=Arabidopsis thaliana GN=CYP710A2 PE=2 SV=1 3 441 1.0E-07
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 281 474 1.0E-07
sp|Q9GQM9|CP6L1_BLAGE Cytochrome P450 6l1 OS=Blattella germanica GN=CYP6L1 PE=2 SV=1 262 467 1.0E-07
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 120 443 2.0E-07
sp|P79152|CP3AJ_CAPHE Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 272 482 2.0E-07
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 272 439 2.0E-07
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 267 488 2.0E-07
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 276 460 2.0E-07
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 272 459 2.0E-07
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 130 439 2.0E-07
sp|Q27519|C13A7_CAEEL Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 283 435 2.0E-07
sp|B9DFU2|MAX1_ARATH Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 223 423 2.0E-07
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 276 426 2.0E-07
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 281 439 2.0E-07
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 51 457 3.0E-07
sp|Q9QZ82|CP11A_MOUSE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 284 435 3.0E-07
sp|P36423|THAS_MOUSE Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 234 423 3.0E-07
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 125 425 3.0E-07
sp|Q6V0L0|CP26C_HUMAN Cytochrome P450 26C1 OS=Homo sapiens GN=CYP26C1 PE=2 SV=2 86 433 3.0E-07
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 120 443 3.0E-07
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 235 435 4.0E-07
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 267 419 5.0E-07
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 11 439 5.0E-07
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 127 441 5.0E-07
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 268 442 6.0E-07
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 282 435 6.0E-07
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 282 435 7.0E-07
sp|Q9VGB4|CP132_DROME Probable cytochrome P450 313a2 OS=Drosophila melanogaster GN=Cyp313a2 PE=3 SV=3 329 447 7.0E-07
sp|P9WPM9|C135B_MYCTU Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp135B1 PE=1 SV=1 273 446 8.0E-07
sp|P9WPM8|C135B_MYCTO Putative cytochrome P450 135B1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp135B1 PE=3 SV=1 273 446 8.0E-07
sp|P63716|C135B_MYCBO Putative cytochrome P450 135B1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp135B1 PE=3 SV=1 273 446 8.0E-07
sp|H2DH19|C7D31_PANGI Cytochrome P450 CYP71D312 OS=Panax ginseng PE=2 SV=1 120 419 8.0E-07
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 282 438 1.0E-06
sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 276 440 1.0E-06
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 280 440 1.0E-06
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 127 435 1.0E-06
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 127 440 1.0E-06
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 281 465 1.0E-06
sp|O13317|TRI11_FUSSP Isotrichodermin C-15 hydroxylase OS=Fusarium sporotrichioides GN=TRI11 PE=3 SV=1 119 441 1.0E-06
sp|P58045|C71AE_ARATH Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 256 449 2.0E-06
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 280 423 2.0E-06
sp|Q9VGH1|CP315_DROME Cytochrome P450 315a1, mitochondrial OS=Drosophila melanogaster GN=sad PE=2 SV=1 281 423 2.0E-06
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 273 443 3.0E-06
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 29 439 3.0E-06
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 282 435 3.0E-06
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 167 423 3.0E-06
sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 329 440 3.0E-06
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 290 441 6.0E-06
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 281 439 8.0E-06
sp|Q9VWR2|CP308_DROME Probable cytochrome P450 308a1 OS=Drosophila melanogaster GN=Cyp308a1 PE=2 SV=2 32 435 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 665 687 22
3 692 714 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4358
MASSLTLWLLGALVLGFCLKTLFFPPAAITRHGKPLRRLPGSLPLIGHGFSLLQGRPKLLAWFVECQQQHGLETM
EFYVPSLPAGVLISDSRNLDFVFKNEALFRKGDFFRSRSRDLFGDGIINVDGDPWRVQRKAGLRFLGMSTIRTLT
DETLPRLLRQSLDSLSASKGRVIDLQAELHEVTTQLMGEMAYDMEMHADDDFTLAFEYAASATAERIQNPLWPLT
ETLTRPGMRRALATVRSRGRQMVAKAVSDGDKPSGTLMRCLLDGIGHEGRVADAALNYLSAGRDTTAQALTWTFY
LLMKHADVVARLRSEAADDKAGGTFALAVFYEALRLYPPIPLELKQAQQDVTLPDGTHLPRNAIVIWCTWAMNRS
STGWGPDAASFRPDRWLSADGQQLVHRPAAEFPVFHGGQRSCLGQRMAEAMAVQVLTTLVPRLDLRPAYTSEADR
RVSRSGLTLPMEGGLPVKLDAHHHPPSPMAAPVVPRLHLFEIDDQPWFPSFLRAIVQNALTAAWSVVHPITGKSA
ANLAASVLVRDLGNRLSSYTYVDFCAGSGGPSPVIERSVNAHLAKRGRPPVDFLLTDLHPNTRAWEKLAMESPHV
KFENASVDASQAPRHLTHQFNRKDVFRIFNLAFHHFDDPLARRILKDTVSKSQGFAIFEMQDRSISSIITVLLFG
VAIFLTMPYYALKWRSPSALFFTYVVPIIPFVLVFDGLISSVRTRTAFEVEALMRGCGVETGSWEVHHGSEPFLW
PFGHMSWIVCRPVRGANGL*
Coding >Ophun1|4358
ATGGCCTCCTCTCTAACTCTCTGGCTCCTCGGCGCCCTCGTCCTGGGCTTCTGCCTCAAGACCCTATTCTTCCCG
CCGGCTGCCATTACACGCCACGGGAAGCCCCTGAGGAGACTCCCGGGCAGCCTGCCTCTCATCGGCCATGGCTTT
TCCTTACTCCAGGGTCGCCCGAAGCTCCTCGCCTGGTTCGTCGAGTGTCAGCAACAGCATGGGCTCGAGACGATG
GAGTTTTACGTGCCGTCGCTTCCAGCCGGTGTGCTCATCAGCGACAGTCGAAACCTCGACTTTGTCTTCAAGAAC
GAGGCCCTGTTTCGAAAGGGAGACTTCTTCAGAAGCCGTTCCCGCGACCTCTTCGGTGACGGCATCATCAACGTC
GATGGAGACCCTTGGCGCGTCCAGCGTAAAGCAGGCCTGCGCTTCCTCGGCATGTCGACGATCCGGACTCTGACG
GACGAGACGCTCCCGCGGTTACTGAGACAGAGCCTCGACTCCCTATCGGCCAGCAAGGGCCGCGTCATCGACCTT
CAAGCCGAGCTGCACGAGGTGACGACGCAGCTTATGGGCGAGATGGCCTACGACATGGAGATGCACGCCGACGAT
GACTTCACCCTCGCCTTCGAGTACGCAGCCAGCGCAACAGCAGAGCGCATACAGAACCCGCTGTGGCCCCTGACG
GAGACCTTGACTCGACCCGGAATGCGCCGCGCGCTGGCCACGGTCCGGAGCCGGGGACGGCAGATGGTGGCCAAG
GCCGTGTCGGACGGGGACAAGCCATCCGGGACGCTGATGCGCTGTCTCCTCGACGGTATCGGTCACGAGGGCCGC
GTCGCCGATGCTGCGCTCAACTACCTCTCGGCTGGACGGGACACGACGGCTCAGGCACTGACCTGGACCTTTTAC
CTTCTGATGAAGCACGCCGACGTCGTGGCCAGGCTTCGATCCGAGGCTGCTGATGACAAGGCCGGCGGCACCTTC
GCCCTCGCCGTCTTCTACGAGGCCCTCCGACTCTACCCCCCGATCCCGCTGGAGCTCAAGCAGGCACAGCAGGAC
GTGACTCTCCCAGACGGAACTCATCTCCCGCGCAACGCCATCGTCATCTGGTGCACGTGGGCCATGAACCGCTCG
AGCACAGGCTGGGGACCGGACGCGGCCTCGTTCCGGCCGGACCGCTGGCTATCGGCCGACGGACAGCAGCTCGTG
CACCGTCCGGCAGCCGAGTTCCCCGTCTTCCACGGCGGACAGCGGTCGTGTCTGGGCCAGCGGATGGCAGAGGCC
ATGGCCGTCCAGGTGCTGACGACGCTGGTGCCGCGCCTCGACTTGCGGCCTGCATATACGAGCGAGGCGGACCGG
CGGGTGAGTCGGAGCGGTTTGACGCTGCCGATGGAGGGGGGATTGCCCGTCAAACTCGACGCCCATCACCACCCT
CCATCCCCAATGGCTGCCCCCGTCGTGCCCCGTCTGCACCTGTTCGAGATCGACGACCAGCCATGGTTCCCCAGC
TTCCTCCGAGCCATCGTCCAGAACGCCCTGACGGCTGCTTGGAGCGTCGTCCATCCCATCACCGGCAAGTCGGCG
GCCAACCTGGCGGCCTCGGTCCTGGTCCGAGATTTGGGCAATCGTCTCTCGTCCTACACCTATGTCGACTTTTGT
GCCGGCTCCGGTGGCCCTTCGCCCGTCATCGAGAGATCCGTCAATGCTCATCTGGCTAAACGTGGTCGTCCGCCC
GTCGACTTCCTCCTGACCGATCTGCATCCCAATACGCGGGCTTGGGAGAAGCTGGCTATGGAGAGTCCCCATGTC
AAGTTTGAGAATGCCAGCGTCGACGCGAGCCAGGCTCCTCGTCATCTCACCCATCAGTTCAATCGCAAGGACGTC
TTCCGCATCTTCAACCTGGCCTTTCATCATTTCGACGACCCCCTGGCCAGGAGGATCCTCAAGGATACCGTCTCC
AAGAGCCAGGGATTCGCCATATTCGAGATGCAGGACCGCAGCATATCGAGCATCATTACCGTCCTGCTCTTCGGC
GTGGCCATCTTCCTCACCATGCCCTACTACGCACTCAAGTGGAGATCGCCCAGCGCCCTCTTCTTCACCTACGTC
GTGCCCATCATCCCGTTTGTCCTCGTCTTTGACGGCCTGATATCCTCCGTTCGTACCCGGACTGCCTTCGAGGTC
GAGGCTCTGATGAGAGGCTGCGGTGTCGAGACGGGCTCGTGGGAGGTTCACCATGGCAGCGAGCCGTTTCTGTGG
CCGTTTGGACATATGAGCTGGATCGTCTGCAGGCCTGTCAGAGGGGCGAATGGCCTGTAA
Transcript >Ophun1|4358
ATGGCCTCCTCTCTAACTCTCTGGCTCCTCGGCGCCCTCGTCCTGGGCTTCTGCCTCAAGACCCTATTCTTCCCG
CCGGCTGCCATTACACGCCACGGGAAGCCCCTGAGGAGACTCCCGGGCAGCCTGCCTCTCATCGGCCATGGCTTT
TCCTTACTCCAGGGTCGCCCGAAGCTCCTCGCCTGGTTCGTCGAGTGTCAGCAACAGCATGGGCTCGAGACGATG
GAGTTTTACGTGCCGTCGCTTCCAGCCGGTGTGCTCATCAGCGACAGTCGAAACCTCGACTTTGTCTTCAAGAAC
GAGGCCCTGTTTCGAAAGGGAGACTTCTTCAGAAGCCGTTCCCGCGACCTCTTCGGTGACGGCATCATCAACGTC
GATGGAGACCCTTGGCGCGTCCAGCGTAAAGCAGGCCTGCGCTTCCTCGGCATGTCGACGATCCGGACTCTGACG
GACGAGACGCTCCCGCGGTTACTGAGACAGAGCCTCGACTCCCTATCGGCCAGCAAGGGCCGCGTCATCGACCTT
CAAGCCGAGCTGCACGAGGTGACGACGCAGCTTATGGGCGAGATGGCCTACGACATGGAGATGCACGCCGACGAT
GACTTCACCCTCGCCTTCGAGTACGCAGCCAGCGCAACAGCAGAGCGCATACAGAACCCGCTGTGGCCCCTGACG
GAGACCTTGACTCGACCCGGAATGCGCCGCGCGCTGGCCACGGTCCGGAGCCGGGGACGGCAGATGGTGGCCAAG
GCCGTGTCGGACGGGGACAAGCCATCCGGGACGCTGATGCGCTGTCTCCTCGACGGTATCGGTCACGAGGGCCGC
GTCGCCGATGCTGCGCTCAACTACCTCTCGGCTGGACGGGACACGACGGCTCAGGCACTGACCTGGACCTTTTAC
CTTCTGATGAAGCACGCCGACGTCGTGGCCAGGCTTCGATCCGAGGCTGCTGATGACAAGGCCGGCGGCACCTTC
GCCCTCGCCGTCTTCTACGAGGCCCTCCGACTCTACCCCCCGATCCCGCTGGAGCTCAAGCAGGCACAGCAGGAC
GTGACTCTCCCAGACGGAACTCATCTCCCGCGCAACGCCATCGTCATCTGGTGCACGTGGGCCATGAACCGCTCG
AGCACAGGCTGGGGACCGGACGCGGCCTCGTTCCGGCCGGACCGCTGGCTATCGGCCGACGGACAGCAGCTCGTG
CACCGTCCGGCAGCCGAGTTCCCCGTCTTCCACGGCGGACAGCGGTCGTGTCTGGGCCAGCGGATGGCAGAGGCC
ATGGCCGTCCAGGTGCTGACGACGCTGGTGCCGCGCCTCGACTTGCGGCCTGCATATACGAGCGAGGCGGACCGG
CGGGTGAGTCGGAGCGGTTTGACGCTGCCGATGGAGGGGGGATTGCCCGTCAAACTCGACGCCCATCACCACCCT
CCATCCCCAATGGCTGCCCCCGTCGTGCCCCGTCTGCACCTGTTCGAGATCGACGACCAGCCATGGTTCCCCAGC
TTCCTCCGAGCCATCGTCCAGAACGCCCTGACGGCTGCTTGGAGCGTCGTCCATCCCATCACCGGCAAGTCGGCG
GCCAACCTGGCGGCCTCGGTCCTGGTCCGAGATTTGGGCAATCGTCTCTCGTCCTACACCTATGTCGACTTTTGT
GCCGGCTCCGGTGGCCCTTCGCCCGTCATCGAGAGATCCGTCAATGCTCATCTGGCTAAACGTGGTCGTCCGCCC
GTCGACTTCCTCCTGACCGATCTGCATCCCAATACGCGGGCTTGGGAGAAGCTGGCTATGGAGAGTCCCCATGTC
AAGTTTGAGAATGCCAGCGTCGACGCGAGCCAGGCTCCTCGTCATCTCACCCATCAGTTCAATCGCAAGGACGTC
TTCCGCATCTTCAACCTGGCCTTTCATCATTTCGACGACCCCCTGGCCAGGAGGATCCTCAAGGATACCGTCTCC
AAGAGCCAGGGATTCGCCATATTCGAGATGCAGGACCGCAGCATATCGAGCATCATTACCGTCCTGCTCTTCGGC
GTGGCCATCTTCCTCACCATGCCCTACTACGCACTCAAGTGGAGATCGCCCAGCGCCCTCTTCTTCACCTACGTC
GTGCCCATCATCCCGTTTGTCCTCGTCTTTGACGGCCTGATATCCTCCGTTCGTACCCGGACTGCCTTCGAGGTC
GAGGCTCTGATGAGAGGCTGCGGTGTCGAGACGGGCTCGTGGGAGGTTCACCATGGCAGCGAGCCGTTTCTGTGG
CCGTTTGGACATATGAGCTGGATCGTCTGCAGGCCTGTCAGAGGGGCGAATGGCCTGTAA
Gene >Ophun1|4358
ATGGCCTCCTCTCTAACTCTCTGGCTCCTCGGCGCCCTCGTCCTGGGCTTCTGCCTCAAGACCCTATTCTTCCCG
CCGGCTGCCATTACACGCCACGGGAAGCCCCTGAGGTGCCATACCAGCTCTTCCTCTCTCTCCTTCCATCCTCTG
ACCCCGCGCTCTAGGAGACTCCCGGGCAGCCTGCCTCTCATCGGCCATGGCTTTTCCTTACTCCAGGGTCGCCCG
AAGCTCCTCGCCTGGTTCGTCGAGTGTCAGCAACAGCATGGGCTCGAGACGATGGAGTTTTACGTGCCGTCGCTT
CCAGCCGGTGTGCTCATCAGCGACAGTCGAAACCTCGACTTTGTCTTCAAGAACGAGGCCCTGTTTCGAAAGGGA
GACTTCTTCAGAAGCCGTTCCCGCGACCTCTTCGGTGACGGCATCATCAACGTCGATGGAGACCCTTGGCGCGTC
CAGCGTAAAGCAGGCCTGCGCTTCCTCGGCATGTCGACGATCCGGACTCTGACGGACGAGACGCTCCCGCGGTTA
CTGAGACAGAGCCTCGACTCCCTATCGGCCAGCAAGGGCCGCGTCATCGACCTTCAAGCCGAGCTGCACGAGGTG
ACGACGCAGCTTATGGGCGAGATGGCCTACGACATGGAGATGCACGCCGACGATGACTTCACCCTCGCCTTCGAG
TACGCAGCCAGCGCAACAGCAGAGCGCATACAGAACCCGCTGTGGCCCCTGACGGAGACCTTGACTCGACCCGGA
ATGCGCCGCGCGCTGGCCACGGTCCGGAGCCGGGGACGGCAGATGGTGGCCAAGGCCGTGTCGGACGGGGACAAG
CCATCCGGGACGCTGATGCGCTGTCTCCTCGACGGTATCGGTCACGAGGGCCGCGTCGCCGATGCTGCGCTCAAC
TACCTCTCGGCTGGACGGGACACGACGGCTCAGGCACTGACCTGGACCTTTTACCTTCTGATGAAGCACGCCGAC
GTCGTGGCCAGGCTTCGATCCGAGGCTGCTGATGACAAGGCCGGCGGCACCTTCGCCCTCGCCGTCTTCTACGAG
GCCCTCCGACTCTACCCCCCGATCCCGCTGGAGCTCAAGCAGGCACAGCAGGACGTGACTCTCCCAGACGGAACT
CATCTCCCGCGCAACGCCATCGTCATCTGGTGCACGTGGGCCATGAACCGCTCGAGCACAGGCTGGGGACCGGAC
GCGGCCTCGTTCCGGCCGGACCGCTGGCTATCGGCCGACGGACAGCAGCTCGTGCACCGTCCGGCAGCCGAGTTC
CCCGTCTTCCACGGCGGACAGCGGTCGTGTCTGGGCCAGCGGATGGCAGAGGCCATGGCCGTCCAGGTGCTGACG
ACGCTGGTGCCGCGCCTCGACTTGCGGCCTGCATATACGAGCGAGGCGGACCGGCGGGTGAGTCGGAGCGGTTTG
ACGCTGCCGATGGAGGGGGGATTGCCCGTGTACGTAGCGTCAAGGGAGGGATGAGGTGTGTAAGTAGGTGTAGAG
ATCGAGGCTGGCTGGAAGCGTCGGCATCGCCGGAAGCATCTTGCTCGGTTCAATTAAGCACGTGTATTCGAATGT
ACGAATATGCACAAGGTAGCATCCGGGCCGGAGCTGCTAGATGCTACTCACTGCATGCGGGCATTTCTCGCAGCA
AGCTTCTAGATACCAGCTAACAAGCTTGATATCTAGGTAGTTGTAAGCCAAGACATTCACAACTCTCAGACACTC
CCAGCTTCATCCGCTGCTACCCGCACACCCGCTAACCTACTACCTTGCCCCCTGACCTCATTCTCCATCCCTTGC
CCCAACTTCGTCCCTCTAGCAATTGAAGCAAACTCGACGCCCATCACCACCCTCCATCCCCAATGGCTGCCCCCG
TCGTGCCCCGTCTGCACCTGTTCGAGATCGACGACCAGCCATGGTTCCCCAGCTTCCTCCGAGCCATCGTCCAGA
ACGCCCTGACGGCTGCTTGGAGCGTCGTCCATCCCATCACCGGCAAGTCGGCGGCCAACCTGGCGGCCTCGGTCC
TGGTCCGAGATTTGGGCAATCGTCTCTCGTCCTACACCTATGTCGACTTTTGTGCCGGCTCCGGTGGCCCTTCGC
CCGTCATCGAGAGATCCGTCAATGCTCATCTGGCTAAACGTGGTCGTCCGCCCGTCGACTTCCTCCTGACCGATC
TGCATCCCAATACGCGGGCTTGGGAGAAGCTGGCTATGGAGAGTCCCCATGTCAAGTTTGAGAATGCCAGCGTCG
ACGCGAGCCAGGCTCCTCGTCATCTCACCCATCAGTTCAATCGCAAGGACGTCTTCCGCATCTTCAACCTGGCCT
TTCATCATTTCGACGACCCCCTGGCCAGGAGGATCCTCAAGGATACCGTCTCCAAGAGCCAGGGATTCGCCATAT
TCGAGATGCAGGACCGCAGCATATCGAGCATCATTACCGTCCTGCTCTTCGGCGTGGCCATCTTCCTCACCATGC
CCTACTACGCACTCAAGTGGAGATCGCCCAGCGCCCTCTTCTTCACCTACGTCGTGCCCATCATCCCGTTTGTCC
TCGTCTTTGACGGCCTGATATCCTCCGTTCGTACCCGGACTGCCTTCGAGGTCGAGGCTCTGATGAGAGGCTGCG
GTGTCGAGACGGGCTCGTGGGAGGTTCACCATGGCAGCGAGCCGTTTCTGTGGCCGTTTGGACATATGAGCTGGA
TCGTCTGCAGGCCTGTCAGAGGGGCGAATGGCCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail