Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4349
Gene name
LocationContig_4:98900..100715
Strand+
Gene length (bp)1815
Transcript length (bp)1707
Coding sequence length (bp)1707
Protein length (aa) 569

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04113 Gpi16 Gpi16 subunit, GPI transamidase component 1.3E-220 14 558

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38875|GPI16_YEAST GPI transamidase component GPI16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI16 PE=1 SV=2 26 551 1.0E-112
sp|O94380|GPI16_SCHPO GPI transamidase component PIG-T homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi16 PE=3 SV=1 1 539 4.0E-94
sp|Q969N2|PIGT_HUMAN GPI transamidase component PIG-T OS=Homo sapiens GN=PIGT PE=1 SV=1 28 536 1.0E-78
sp|Q8BXQ2|PIGT_MOUSE GPI transamidase component PIG-T OS=Mus musculus GN=Pigt PE=1 SV=2 28 557 6.0E-77

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0044238 primary metabolic process No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:1905369 endopeptidase complex No
GO:0008303 caspase complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1905368 peptidase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 513 535 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4349
MRRPPALLLIASLVASLSSFAVAADYHEQLTLRPLPLSALLASFNFRSNTSLADFEAHHFRLFPRSLAQILQHAR
TRELHLRFTLGRWDAERWGARPWGGAREGGTGVELWAWLDRDADDNWRTLTNALSGLFCASLNFIDSTRTTRPVV
SFQPEGHHSKATLGTTSLLHGVLPHEVVCTENLTPFLKLLPCKGKAGIASLLDGHKLFDASFQSMAIDTIDMVLD
VERSKRPRDNPIPRPPPSQELLCDTSKAYHGDGVCYPTDHLHGQHWKLSEIFGRAMKGVCPLTDGITPPVCLQVP
DSRFVFATGASRDIRDPGGMSRCYIPDDDAVEFNFELTKPSSADAAASKDLVRPETPLLYAERSFMGHGQEHGGV
QAILTNPGDTEVDFVYMESLPWFMRIYLHTLSTRISSSSAATNASTRIIEEIYYRPALDRTRGTQLELLMRIPAR
CTVFLTYDFSKSILRYTEYPPDANRGFDVAAAVITTRDPRAGLNLRTTSLLLYLPTPDFSMPYNVIIFTSTAIAL
TFGGLYNILVRRLVGADEAPNTMLKTKVARLLGLLKTRLQGSA*
Coding >Ophun1|4349
ATGCGTCGCCCCCCGGCGCTCCTCCTGATCGCGAGTCTCGTTGCCAGCCTCTCGAGCTTCGCTGTCGCCGCCGAT
TACCACGAGCAGCTCACCCTACGCCCGCTACCGCTCTCGGCTCTTCTCGCGAGCTTCAACTTTCGATCTAACACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGCCTCTTCCCCCGGTCGCTGGCCCAAATTCTACAACATGCTCGC
ACACGCGAGCTCCACCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGGTGGGGCGCTCGGCCCTGGGGAGGT
GCTCGTGAGGGTGGCACTGGAGTTGAGCTGTGGGCTTGGCTGGACAGAGACGCCGACGATAATTGGCGGACGCTG
ACCAACGCCCTCTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACACGCACGACCCGCCCTGTCGTG
TCCTTCCAACCCGAGGGCCATCACTCTAAAGCCACTCTCGGCACCACAAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAGAATTTGACGCCCTTCCTGAAGCTGCTGCCCTGCAAGGGCAAGGCTGGAATCGCCAGT
CTGCTAGATGGGCATAAGCTGTTTGACGCCTCGTTCCAAAGCATGGCCATTGATACCATCGACATGGTGCTTGAT
GTCGAACGCTCCAAGCGGCCAAGAGATAATCCCATTCCGAGACCTCCCCCAAGTCAGGAGCTTCTCTGTGACACG
TCCAAGGCCTACCACGGTGATGGCGTCTGCTACCCAACCGATCATCTGCATGGCCAGCACTGGAAGCTATCCGAG
ATCTTCGGCCGCGCCATGAAGGGCGTGTGTCCCTTGACCGACGGCATCACGCCCCCTGTGTGTCTGCAGGTCCCC
GACTCCCGATTCGTGTTCGCTACCGGCGCCTCCCGCGATATCAGAGACCCCGGCGGAATGTCAAGATGTTATATA
CCGGACGACGACGCCGTCGAGTTCAACTTTGAGCTCACGAAACCAAGCTCTGCCGACGCGGCGGCATCCAAGGAT
CTGGTTCGGCCGGAAACGCCACTTCTCTACGCGGAACGAAGCTTCATGGGTCACGGTCAGGAACACGGCGGCGTC
CAGGCCATCCTGACCAACCCCGGCGACACCGAGGTCGACTTTGTCTACATGGAGTCGCTTCCCTGGTTCATGCGA
ATCTACCTCCACACACTATCTACGCGCATCTCGTCCTCTTCCGCCGCCACAAACGCCTCTACGCGCATCATCGAG
GAGATCTACTACCGTCCGGCTCTCGACCGCACCCGCGGCACTCAGCTGGAGCTCCTCATGCGCATACCCGCCCGC
TGCACCGTCTTCCTCACCTACGACTTCTCCAAGTCCATCCTGCGGTATACCGAGTATCCGCCCGACGCCAACCGC
GGCTTCGACGTCGCCGCCGCCGTCATCACTACTCGCGACCCGCGCGCTGGCCTCAACTTGCGTACTACCAGCTTG
TTGCTGTACCTGCCGACACCGGACTTTAGCATGCCGTATAATGTCATCATCTTCACCTCGACGGCCATAGCCCTG
ACCTTTGGTGGCCTGTACAACATTCTGGTTAGAAGGCTGGTGGGAGCAGATGAGGCGCCGAATACGATGCTCAAG
ACCAAGGTTGCCCGGCTTCTGGGTCTGCTCAAGACGCGGCTGCAAGGGAGCGCCTGA
Transcript >Ophun1|4349
ATGCGTCGCCCCCCGGCGCTCCTCCTGATCGCGAGTCTCGTTGCCAGCCTCTCGAGCTTCGCTGTCGCCGCCGAT
TACCACGAGCAGCTCACCCTACGCCCGCTACCGCTCTCGGCTCTTCTCGCGAGCTTCAACTTTCGATCTAACACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGCCTCTTCCCCCGGTCGCTGGCCCAAATTCTACAACATGCTCGC
ACACGCGAGCTCCACCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGGTGGGGCGCTCGGCCCTGGGGAGGT
GCTCGTGAGGGTGGCACTGGAGTTGAGCTGTGGGCTTGGCTGGACAGAGACGCCGACGATAATTGGCGGACGCTG
ACCAACGCCCTCTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACACGCACGACCCGCCCTGTCGTG
TCCTTCCAACCCGAGGGCCATCACTCTAAAGCCACTCTCGGCACCACAAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAGAATTTGACGCCCTTCCTGAAGCTGCTGCCCTGCAAGGGCAAGGCTGGAATCGCCAGT
CTGCTAGATGGGCATAAGCTGTTTGACGCCTCGTTCCAAAGCATGGCCATTGATACCATCGACATGGTGCTTGAT
GTCGAACGCTCCAAGCGGCCAAGAGATAATCCCATTCCGAGACCTCCCCCAAGTCAGGAGCTTCTCTGTGACACG
TCCAAGGCCTACCACGGTGATGGCGTCTGCTACCCAACCGATCATCTGCATGGCCAGCACTGGAAGCTATCCGAG
ATCTTCGGCCGCGCCATGAAGGGCGTGTGTCCCTTGACCGACGGCATCACGCCCCCTGTGTGTCTGCAGGTCCCC
GACTCCCGATTCGTGTTCGCTACCGGCGCCTCCCGCGATATCAGAGACCCCGGCGGAATGTCAAGATGTTATATA
CCGGACGACGACGCCGTCGAGTTCAACTTTGAGCTCACGAAACCAAGCTCTGCCGACGCGGCGGCATCCAAGGAT
CTGGTTCGGCCGGAAACGCCACTTCTCTACGCGGAACGAAGCTTCATGGGTCACGGTCAGGAACACGGCGGCGTC
CAGGCCATCCTGACCAACCCCGGCGACACCGAGGTCGACTTTGTCTACATGGAGTCGCTTCCCTGGTTCATGCGA
ATCTACCTCCACACACTATCTACGCGCATCTCGTCCTCTTCCGCCGCCACAAACGCCTCTACGCGCATCATCGAG
GAGATCTACTACCGTCCGGCTCTCGACCGCACCCGCGGCACTCAGCTGGAGCTCCTCATGCGCATACCCGCCCGC
TGCACCGTCTTCCTCACCTACGACTTCTCCAAGTCCATCCTGCGGTATACCGAGTATCCGCCCGACGCCAACCGC
GGCTTCGACGTCGCCGCCGCCGTCATCACTACTCGCGACCCGCGCGCTGGCCTCAACTTGCGTACTACCAGCTTG
TTGCTGTACCTGCCGACACCGGACTTTAGCATGCCGTATAATGTCATCATCTTCACCTCGACGGCCATAGCCCTG
ACCTTTGGTGGCCTGTACAACATTCTGGTTAGAAGGCTGGTGGGAGCAGATGAGGCGCCGAATACGATGCTCAAG
ACCAAGGTTGCCCGGCTTCTGGGTCTGCTCAAGACGCGGCTGCAAGGGAGCGCCTGA
Gene >Ophun1|4349
ATGCGTCGCCCCCCGGCGCTCCTCCTGATCGCGAGTCTCGTTGCCAGCCTCTCGAGCTTCGCTGTCGCCGCCGAT
TACCACGAGCAGCTCACCCTACGCCCGCTACCGCTCTCGGCTCTTCTCGCGAGCTTCAACTTTCGATCTAACACG
TCTCTCGCCGACTTCGAGGCTCATCACTTTCGCCTCTTCCCCCGGTCGCTGGCCCAAATTCTACAACATGCTCGC
ACACGCGAGCTCCACCTGCGCTTCACCCTCGGCCGCTGGGACGCCGAGCGGTGGGGCGCTCGGCCCTGGGGAGGT
GCTCGTGAGGGTGGCACTGGAGTTGAGCTGTGGGCTTGGCTGGACAGAGACGCCGACGATAATTGGCGGACGCTG
ACCAACGCCCTCTCTGGCCTCTTCTGCGCTTCGCTCAACTTCATCGACTCGACACGCACGACCCGCCCTGTCGTG
TCCTTCCAACCCGAGGGCCATCACTCTAAAGCCACTCTCGGCACCACAAGCCTGCTTCACGGCGTGCTCCCTCAC
GAGGTCGTTTGTACCGAGAATTTGACGCCCTTCCTGAAGCTGCTGCCCTGCAAGGGCAAGGCTGGAATCGCCAGT
CTGCTAGATGGGCATAAGCTGTTTGACGCCTCGTTCCAAAGCATGGCCATTGATGTGAGGCCTGTCTGTGACTCT
CATGGCGTCTGTGTTCTACAAATGGAACAGACCATCGACATGGTGCTTGATGTCGAACGCTCCAAGCGGCCAAGA
GGTGTGCTCTTCTCTTCCCCCCACCCCCTTCCAGAATTACAGACTAACTGGCGTTGAGATAATCCCATTCCGAGA
CCTCCCCCAAGTCAGGAGCTTCTCTGTGACACGTCCAAGGCCTACCACGGTGATGGCGTCTGCTACCCAACCGAT
CATCTGCATGGCCAGCACTGGAAGCTATCCGAGATCTTCGGCCGCGCCATGAAGGGCGTGTGTCCCTTGACCGAC
GGCATCACGCCCCCTGTGTGTCTGCAGGTCCCCGACTCCCGATTCGTGTTCGCTACCGGCGCCTCCCGCGATATC
AGAGACCCCGGCGGAATGTCAAGATGTTATATACCGGACGACGACGCCGTCGAGTTCAACTTTGAGCTCACGAAA
CCAAGCTCTGCCGACGCGGCGGCATCCAAGGATCTGGTTCGGCCGGAAACGCCACTTCTCTACGCGGAACGAAGC
TTCATGGGTCACGGTCAGGAACACGGCGGCGTCCAGGCCATCCTGACCAACCCCGGCGACACCGAGGTCGACTTT
GTCTACATGGAGTCGCTTCCCTGGTTCATGCGAATCTACCTCCACACACTATCTACGCGCATCTCGTCCTCTTCC
GCCGCCACAAACGCCTCTACGCGCATCATCGAGGAGATCTACTACCGTCCGGCTCTCGACCGCACCCGCGGCACT
CAGCTGGAGCTCCTCATGCGCATACCCGCCCGCTGCACCGTCTTCCTCACCTACGACTTCTCCAAGTCCATCCTG
CGGTATACCGAGTATCCGCCCGACGCCAACCGCGGCTTCGACGTCGCCGCCGCCGTCATCACTACTCGCGACCCG
CGCGCTGGCCTCAACTTGCGTACTACCAGCTTGTTGCTGTACCTGCCGACACCGGACTTTAGCATGCCGTATAAT
GTCATCATCTTCACCTCGACGGCCATAGCCCTGACCTTTGGTGGCCTGTACAACATTCTGGTTAGAAGGCTGGTG
GGAGCAGATGAGGCGCCGAATACGATGCTCAAGACCAAGGTTGCCCGGCTTCTGGGTCTGCTCAAGACGCGGCTG
CAAGGGAGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail