Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4344
Gene name
LocationContig_4:87594..89340
Strand-
Gene length (bp)1746
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06699 PIG-F GPI biosynthesis protein family Pig-F 4.9E-55 58 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q871U9|GPI11_NEUCR Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpi-11 PE=3 SV=1 38 241 1.0E-66
sp|Q4HXT5|GPI11_GIBZE Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI11 PE=3 SV=1 29 238 3.0E-65
sp|P0C148|GPI11_MAGO7 Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GPI11 PE=3 SV=2 72 239 7.0E-47
sp|Q4WIQ0|GPI11_ASPFU Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi11 PE=3 SV=1 23 238 2.0E-40
sp|Q6C741|GPI11_YARLI Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI11 PE=3 SV=1 75 238 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q871U9|GPI11_NEUCR Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpi-11 PE=3 SV=1 38 241 1.0E-66
sp|Q4HXT5|GPI11_GIBZE Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI11 PE=3 SV=1 29 238 3.0E-65
sp|P0C148|GPI11_MAGO7 Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GPI11 PE=3 SV=2 72 239 7.0E-47
sp|Q4WIQ0|GPI11_ASPFU Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi11 PE=3 SV=1 23 238 2.0E-40
sp|Q6C741|GPI11_YARLI Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI11 PE=3 SV=1 75 238 2.0E-28
sp|Q6BHK4|GPI11_DEBHA Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI11 PE=3 SV=2 23 238 2.0E-15
sp|Q9Y7P2|YCKF_SCHPO Uncharacterized protein C1450.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.15 PE=3 SV=2 148 238 7.0E-15
sp|Q5AFT2|GPI11_CANAL Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI11 PE=3 SV=1 17 234 9.0E-14
sp|Q06636|GPI11_YEAST Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI11 PE=1 SV=1 127 238 3.0E-12
sp|Q07326|PIGF_HUMAN Phosphatidylinositol-glycan biosynthesis class F protein OS=Homo sapiens GN=PIGF PE=1 SV=1 44 238 7.0E-12
sp|O09101|PIGF_MOUSE Phosphatidylinositol-glycan biosynthesis class F protein OS=Mus musculus GN=Pigf PE=1 SV=1 44 238 1.0E-10
sp|Q75EY7|GPI11_ASHGO Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI11 PE=3 SV=1 117 238 2.0E-10
sp|Q6FSD1|GPI11_CANGA Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI11 PE=3 SV=1 84 238 4.0E-10
sp|Q6CTT3|GPI11_KLULA Glycosylphosphatidylinositol anchor biosynthesis protein 11 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI11 PE=3 SV=1 84 238 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0009247 glycolipid biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006643 membrane lipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0019538 protein metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006497 protein lipidation No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0006629 lipid metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0031090 organelle membrane No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0008150 biological_process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0005575 cellular_component No
GO:0006793 phosphorus metabolic process No
GO:0036211 protein modification process No
GO:0006664 glycolipid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043412 macromolecule modification No
GO:0016020 membrane No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22
2 120 142 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4344
MVPQLSLIRPAATMPAADMQQGPSPMSGSKAAPRQKTSVEAVPILDTPLARTVSLARPVTLAGLLAGRFGALVAD
PVAALGSGLAVVVAVQVLYAVVCLPAAGSKATKRARPGERRKGSSAVGGPGGVSTALLSLALTAMATPVAFAMMV
LFGAPLLNDVAKTMLCAAHLSVLGLFPIFYARGVDGEALVSVAGASAPLDETFGGLVGGVVGGWLGAVPIPLDWD
RAWQRWPVTIVVGVPGSAAASGHRPSEATPSSLGDLTERHRSVDDSLESLVKLERSGSGGR*
Coding >Ophun1|4344
ATGGTGCCGCAGCTTTCCCTCATCCGGCCCGCGGCGACGATGCCGGCGGCAGATATGCAACAAGGGCCGTCTCCC
ATGAGCGGCAGTAAAGCAGCACCCAGGCAGAAAACGAGCGTCGAAGCCGTGCCCATACTCGACACGCCCCTCGCG
CGGACCGTCTCGCTAGCCCGGCCGGTGACGCTGGCCGGGTTGCTGGCTGGGCGCTTTGGCGCGCTGGTGGCAGAT
CCGGTGGCCGCGTTGGGGTCGGGACTGGCAGTCGTCGTGGCGGTACAGGTCCTTTACGCTGTCGTCTGCTTGCCG
GCGGCGGGTTCCAAGGCGACTAAAAGAGCTCGTCCGGGTGAGAGACGGAAGGGCTCATCAGCAGTTGGGGGTCCG
GGTGGCGTATCGACGGCTTTGCTCTCGTTGGCGCTGACAGCCATGGCGACACCCGTCGCGTTTGCCATGATGGTT
CTCTTCGGCGCCCCGCTTCTCAACGACGTGGCCAAGACGATGCTATGTGCGGCGCATCTTTCGGTCTTGGGCCTG
TTCCCCATCTTCTACGCCCGCGGAGTGGACGGCGAAGCGCTGGTTTCCGTGGCGGGAGCGTCTGCGCCCCTGGAC
GAGACGTTTGGCGGACTCGTCGGCGGCGTCGTCGGCGGTTGGTTAGGGGCGGTGCCCATTCCGCTTGATTGGGAT
CGGGCGTGGCAGCGGTGGCCGGTGACGATTGTCGTCGGTGTTCCGGGGAGCGCGGCGGCGTCGGGGCATCGTCCG
AGCGAGGCCACGCCGTCGTCACTGGGAGACCTGACCGAACGGCACAGATCCGTGGATGACTCGCTGGAGTCGCTG
GTGAAGCTCGAGCGTAGCGGATCCGGCGGCCGCTGA
Transcript >Ophun1|4344
ATGGTGCCGCAGCTTTCCCTCATCCGGCCCGCGGCGACGATGCCGGCGGCAGATATGCAACAAGGGCCGTCTCCC
ATGAGCGGCAGTAAAGCAGCACCCAGGCAGAAAACGAGCGTCGAAGCCGTGCCCATACTCGACACGCCCCTCGCG
CGGACCGTCTCGCTAGCCCGGCCGGTGACGCTGGCCGGGTTGCTGGCTGGGCGCTTTGGCGCGCTGGTGGCAGAT
CCGGTGGCCGCGTTGGGGTCGGGACTGGCAGTCGTCGTGGCGGTACAGGTCCTTTACGCTGTCGTCTGCTTGCCG
GCGGCGGGTTCCAAGGCGACTAAAAGAGCTCGTCCGGGTGAGAGACGGAAGGGCTCATCAGCAGTTGGGGGTCCG
GGTGGCGTATCGACGGCTTTGCTCTCGTTGGCGCTGACAGCCATGGCGACACCCGTCGCGTTTGCCATGATGGTT
CTCTTCGGCGCCCCGCTTCTCAACGACGTGGCCAAGACGATGCTATGTGCGGCGCATCTTTCGGTCTTGGGCCTG
TTCCCCATCTTCTACGCCCGCGGAGTGGACGGCGAAGCGCTGGTTTCCGTGGCGGGAGCGTCTGCGCCCCTGGAC
GAGACGTTTGGCGGACTCGTCGGCGGCGTCGTCGGCGGTTGGTTAGGGGCGGTGCCCATTCCGCTTGATTGGGAT
CGGGCGTGGCAGCGGTGGCCGGTGACGATTGTCGTCGGTGTTCCGGGGAGCGCGGCGGCGTCGGGGCATCGTCCG
AGCGAGGCCACGCCGTCGTCACTGGGAGACCTGACCGAACGGCACAGATCCGTGGATGACTCGCTGGAGTCGCTG
GTGAAGCTCGAGCGTAGCGGATCCGGCGGCCGCTGA
Gene >Ophun1|4344
ATGGTGCCGCAGCTTGTGAGAGGACAGCGTAGGGCTGGACGGTCTTTCGGTTCTTCGCACCATTGTGCGCTGAGC
AGTCAATGTCTACTGCACCCTCCAAGAGTTGGATGTCGGACCCCGGAACTCGCTCGGACGATCCATGGATGTTCA
TCACGTGATGTCACCCGGTCGCCATGGTCACGTGGATCGGCTACAAGCTGTTCTTTGCCTTCACAGAGCAAGGGC
AAGCAAGGCTCGCCTCGAATACGTGCAGTCCCTCATCCGGCCCGCGGCGACGATGCCGGCGGCAGATATGCAACA
AGGGCCGTCTCCCATGAGCGGCAGTAAAGCAGCACCCAGGCAGAAAACGAGCGTCGAAGCCGTGCCCATACTCGA
CACGCCCCTCGCGCGGACCGTCTCGCTAGCCCGGCCGGTGACGCTGGCCGGGTTGCTGGCTGGGCGCTTTGGCGC
GCTGGTGGCAGATCCGGTGGCCGCGTTGGGGTCGGGACTGGCAGTCGTCGTGGCGGTACAGGTCCTTTACGCTGT
CGTCTGCTTGCCGGCGGCGGGTTCCAAGGCGACTAAAAGAGCTCGTCCGGGTGAGAGACGGAAGGGCTCATCAGC
AGTTGGGGGTCCGGGTGGCGTATCGGTAAGGGTCCGGGCGAGAACGACGTGACGTGGAGAGAAGACATCTAACGA
CTGGGGATTAACTGCAGACGGCTTTGCTCTCGTTGGCGCTGACAGCCATGGCGACACCCGTCGCGTTTGCCATGA
TGGTTCTCTTCGGCGCCCCGCTTCTCAACGACGTGGCCAAGACGATGCTATGTGCGGCGCATCTTTCGGTCTTGG
GCCTGTTCCCCATCTTCTACGCCCGCGGAGTGGACGGCGAAGCGCTGGTTTCCGTGGCGGGAGCGTCTGCGCCCC
TGGACGAGACGTTTGGCGGACTCGTCGGCGGCGTCGTCGGCGGTTGGTTAGGGGCGGTGCCCATTCCGCTTGATT
GGGATCGGGCGTGGCAGCGGTGGCCGGTGACGATTGTCGTCGGTGTGTACGTGGGATCGCTACTTGGCAGTTGTC
TAGCTGGGACCGGGTGGCTCTACGGCCGGAGCTTGGGTGGGGAGCAGAAGGAGGATAAGGAGGATTCGCAGGGGA
AGGGGAAAGGAGAGATGGCGGCGGCGGGTAGCAGCCGGTAAAGACGAGAGGAGCTAATGAGTCGTCGTTGATATC
CGGGTTGTGGTTTGTGACCGGCGGTCTGGGGACTCTTCTTGGCGAAGATCAGGGAAAGCCCCCTGGAAAACAGGG
TGGGGTAGGGGAATAGGTGGGGCGTGACGAAGACGGATTGAATCATTCATCAGATGACTCGGACGTAAACAACGT
CAAAAGAAGCCGAGACATTACTGATGATGGCGACTCGTCAACCAGTTCGGCGGTGGCGGCGCGTCGTCAGCGACT
TGGAAGAGATGGGGTTTGGATCCAGACGGCGGCATGACGTAACTGTGTCTAACGGGGGCAGTGCGCGAGGCGTTG
ACGTCATGGCTAGGTCGCAACCTGTTGCCTGGAGGCTGGGATAGGTAGACAATCAGAGTTACCTACGAATACTAG
GCAAGGTATTGGCAGTTCTGGAGCAGTCCGGGGAGCGCGGCGGCGTCGGGGCATCGTCCGAGCGAGGCCACGCCG
TCGTCACTGGGAGACCTGACCGAACGGCACAGATCCGTGGATGACTCGCTGGAGTCGCTGGTGAAGCTCGAGCGT
AGCGGATCCGGCGGCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail