Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4339
Gene name
LocationContig_4:76774..77271
Strand-
Gene length (bp)497
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01084 Ribosomal_S18 Ribosomal protein S18 3.1E-13 73 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZR01|RSM18_YEAS7 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=RSM18 PE=3 SV=1 9 117 2.0E-09
sp|B5VHI3|RSM18_YEAS6 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSM18 PE=3 SV=2 9 117 2.0E-09
sp|B3LS63|RSM18_YEAS1 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSM18 PE=3 SV=2 9 117 2.0E-09
sp|P40033|RSM18_YEAST 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM18 PE=1 SV=2 9 117 2.0E-09
sp|Q1GC35|RS18_LACDA 30S ribosomal protein S18 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsR PE=3 SV=1 73 121 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZR01|RSM18_YEAS7 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=RSM18 PE=3 SV=1 9 117 2.0E-09
sp|B5VHI3|RSM18_YEAS6 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSM18 PE=3 SV=2 9 117 2.0E-09
sp|B3LS63|RSM18_YEAS1 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSM18 PE=3 SV=2 9 117 2.0E-09
sp|P40033|RSM18_YEAST 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM18 PE=1 SV=2 9 117 2.0E-09
sp|Q1GC35|RS18_LACDA 30S ribosomal protein S18 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsR PE=3 SV=1 73 121 1.0E-07
sp|Q4G3D9|RR18_EMIHU 30S ribosomal protein S18, chloroplastic OS=Emiliania huxleyi GN=rps18 PE=3 SV=1 48 121 4.0E-07
sp|Q04CW7|RS18_LACDB 30S ribosomal protein S18 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsR PE=3 SV=1 73 121 9.0E-07
sp|Q6F235|RS18_MESFL 30S ribosomal protein S18 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsR PE=3 SV=1 73 123 1.0E-06
sp|A8YW49|RS18_LACH4 30S ribosomal protein S18 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsR PE=3 SV=1 73 121 1.0E-06
sp|Q1AXR1|RS18_RUBXD 30S ribosomal protein S18 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsR PE=3 SV=1 73 121 2.0E-06
sp|Q4JTZ6|RS18_CORJK 30S ribosomal protein S18 OS=Corynebacterium jeikeium (strain K411) GN=rpsR PE=3 SV=1 73 119 2.0E-06
sp|Q5FN07|RS18_LACAC 30S ribosomal protein S18 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsR PE=3 SV=1 73 121 2.0E-06
sp|Q6MUK6|RS18_MYCMS 30S ribosomal protein S18 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpsR PE=3 SV=1 73 121 4.0E-06
sp|B1VFG0|RS18_CORU7 30S ribosomal protein S18 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpsR PE=3 SV=1 73 119 4.0E-06
sp|Q9USL7|RSM18_SCHPO 37S ribosomal protein rsm18, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsm18 PE=3 SV=1 33 122 6.0E-06
sp|Q20EV2|RR18_OLTVI 30S ribosomal protein S18, chloroplastic OS=Oltmannsiellopsis viridis GN=rps18 PE=3 SV=1 73 122 6.0E-06
sp|Q839Y8|RS18_ENTFA 30S ribosomal protein S18 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsR PE=3 SV=1 73 124 6.0E-06
sp|Q8RIE4|RS18_FUSNN 30S ribosomal protein S18 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsR PE=3 SV=1 47 119 7.0E-06
sp|Q03UT3|RS18_LEUMM 30S ribosomal protein S18 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsR PE=3 SV=1 73 123 9.0E-06
sp|B1MWV2|RS18_LEUCK 30S ribosomal protein S18 OS=Leuconostoc citreum (strain KM20) GN=rpsR PE=3 SV=1 73 123 9.0E-06
sp|Q047E6|RS18_LACGA 30S ribosomal protein S18 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsR PE=3 SV=1 73 121 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2160
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4163
Ophiocordyceps australis map64 (Brazil) OphauB2|6413
Ophiocordyceps camponoti-floridani Ophcf2|05388
Ophiocordyceps camponoti-rufipedis Ophun1|4339 (this protein)
Ophiocordyceps kimflemingae Ophio5|5629
Ophiocordyceps subramaniannii Hirsu2|2662

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4339
MQRAAESVEAVSMTVSKKKQAEALLRRMPRRFEPGDLYAPHDLSPVEMHKHRTKTRRDSDVVDALNLRPRDMYKN
FSLIQDFTNSAGQIQPRSVTGLRPVNQRRIAKMVRRAQGMGIYPSVHDHPEALRNRFFNPDGKWSMERNR*
Coding >Ophun1|4339
ATGCAGCGCGCTGCTGAGAGCGTCGAGGCCGTGTCGATGACCGTCTCCAAGAAGAAGCAGGCCGAGGCCCTCTTG
AGGCGGATGCCGCGTCGTTTCGAGCCGGGTGACCTATACGCGCCGCACGATCTCAGCCCCGTTGAGATGCATAAG
CATCGTACCAAGACGAGGCGTGATAGTGACGTTGTTGATGCGTTGAACCTTCGTCCGCGGGACATGTACAAGAAC
TTCTCCCTCATCCAAGACTTCACCAACTCGGCCGGCCAGATTCAGCCAAGATCCGTCACCGGCTTGCGTCCCGTC
AACCAACGCAGAATCGCAAAAATGGTTCGCCGCGCTCAAGGCATGGGCATCTATCCCTCCGTCCACGATCACCCC
GAGGCCCTGCGTAATCGCTTCTTCAATCCCGACGGTAAATGGTCTATGGAACGCAACAGGTAG
Transcript >Ophun1|4339
ATGCAGCGCGCTGCTGAGAGCGTCGAGGCCGTGTCGATGACCGTCTCCAAGAAGAAGCAGGCCGAGGCCCTCTTG
AGGCGGATGCCGCGTCGTTTCGAGCCGGGTGACCTATACGCGCCGCACGATCTCAGCCCCGTTGAGATGCATAAG
CATCGTACCAAGACGAGGCGTGATAGTGACGTTGTTGATGCGTTGAACCTTCGTCCGCGGGACATGTACAAGAAC
TTCTCCCTCATCCAAGACTTCACCAACTCGGCCGGCCAGATTCAGCCAAGATCCGTCACCGGCTTGCGTCCCGTC
AACCAACGCAGAATCGCAAAAATGGTTCGCCGCGCTCAAGGCATGGGCATCTATCCCTCCGTCCACGATCACCCC
GAGGCCCTGCGTAATCGCTTCTTCAATCCCGACGGTAAATGGTCTATGGAACGCAACAGGTAG
Gene >Ophun1|4339
ATGCAGCGCGCTGCTGAGAGCGTCGAGGCCGTGTCGATGACCGTCTCCAAGAAGAAGCAGGCCGAGGCCCTCTTG
AGGCGGATGCCGCGTCGTTTCGAGCCGGGTGACCTATACGCGCCGCACGATCTCAGCCCCGTTGAGATGCATAAG
CATCGTACCAAGACGAGGCGTGATAGTGACGTTGTTGATGCGTTGAACCTTCGTCCGCGGGACATGTACAAGGTG
CGCAGCCACGATGCTTCTTACGAGCAATCGCAAGATGCCAATGCTGACCATGTCAGAACTTCTCCCTCATCCAAG
ACTTCACCAACTCGGCCGGCCAGATTCAGCCAAGATCCGTCACCGGCTTGCGTCCCGTCAACCAACGCAGAATCG
CAAAAATGGTTCGCCGCGCTCAAGGCATGGGCATCTATCCCTCCGTCCACGATCACCCCGAGGCCCTGCGTAATC
GCTTCTTCAATCCCGACGGTAAATGGTCTATGGAACGCAACAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail