Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4336
Gene name
LocationContig_4:69291..70692
Strand+
Gene length (bp)1401
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 2.1E-06 331 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 183 443 2.0E-11
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 158 435 3.0E-11
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 206 430 1.0E-07
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 206 430 2.0E-07
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 206 430 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 183 443 2.0E-11
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 158 435 3.0E-11
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 206 430 1.0E-07
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 206 430 2.0E-07
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 206 430 2.0E-07
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 248 430 3.0E-07
sp|Q8R314|S35F5_MOUSE Solute carrier family 35 member F5 OS=Mus musculus GN=Slc35f5 PE=2 SV=1 206 430 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 89 107 18
2 122 144 22
3 191 213 22
4 223 242 19
5 251 270 19
6 285 304 19
7 324 346 22
8 361 383 22
9 388 410 22
10 415 437 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4336
MDADGSGAHEARGPEAVPVSSPERHPEPAGMPLLYKPETAESNGEAGTSLLWPDDDDGDGRPPPMSRRSTMRSRS
PLAAAAAAQARKKYTYAAFFLAVSLVTFAIQTELSAHIQHDLGWDKAYCMMYFTHGSWIVLWPAMLLVLRLQKRD
EPWPVFWRRHRQMLASTVAMIELQTLDVFTPSAQRRARPAMYLIRTTAFITSALTVAGLSWYVAVSLTTPSDLTA
IYNCSAFFAYVFSVPILREPLRLDKSVAVFIAIVGVLIVAYGDTGESVGKGHQPGAGSRFVGNLVIGIGSVLYGL
YEVLYKRYACPPDGVSPGRGTIFANTFGACIGFFTLTVLWIPLPILHVLGIEKFELPDASTGWLVLVAVLANATF
SGSFLVLISLTSPVLSSVAALLTIFIVALADWFLTGQPLSWAAIIGGSMIIVAFLGLSWSTYREMTEHEARKLSV
DLTDSEEDADRAAADA*
Coding >Ophun1|4336
ATGGACGCCGACGGTAGCGGAGCCCACGAGGCCCGCGGCCCCGAAGCCGTCCCCGTCTCCTCTCCCGAACGTCAT
CCCGAGCCCGCCGGCATGCCGCTGCTGTACAAGCCCGAGACGGCCGAGTCCAACGGAGAGGCCGGCACCAGCCTC
CTGTGGCCCGACGACGATGACGGCGACGGTCGCCCTCCGCCCATGAGCCGCCGGTCGACAATGCGCAGCCGGAGC
CCCCTCGCCGCCGCCGCCGCCGCCCAGGCTCGCAAAAAGTACACCTACGCCGCCTTCTTCCTCGCCGTCAGCCTC
GTCACCTTTGCCATCCAGACGGAGCTCAGCGCCCATATACAGCACGATCTCGGCTGGGACAAGGCCTACTGCATG
ATGTACTTCACCCACGGCTCCTGGATCGTCCTGTGGCCCGCCATGCTGCTGGTCTTGCGCCTCCAGAAGCGTGAC
GAGCCGTGGCCCGTCTTCTGGCGCCGTCACAGGCAGATGCTGGCCTCGACCGTCGCAATGATTGAGCTGCAGACG
CTCGATGTCTTCACTCCGTCGGCCCAGCGCCGGGCTCGTCCCGCCATGTATCTGATCCGCACCACGGCCTTCATC
ACCTCGGCCCTGACTGTGGCCGGTCTCAGCTGGTACGTGGCCGTCAGCCTGACGACGCCCTCGGACCTGACGGCC
ATCTACAACTGCTCCGCCTTCTTCGCCTATGTCTTCTCCGTGCCCATCCTGCGCGAGCCTTTGCGCCTCGATAAG
TCGGTTGCCGTCTTCATCGCCATCGTCGGCGTCCTCATCGTCGCCTACGGAGACACGGGCGAGTCAGTCGGCAAG
GGCCATCAGCCCGGCGCTGGCAGCCGCTTCGTCGGCAATCTCGTCATTGGCATCGGCTCCGTCCTCTACGGCTTG
TACGAGGTGCTGTACAAGCGTTACGCCTGTCCGCCCGATGGCGTCTCCCCCGGACGCGGCACCATCTTCGCCAAC
ACATTCGGCGCCTGCATCGGCTTCTTCACTCTGACGGTTCTGTGGATCCCGCTGCCCATTCTGCACGTCCTGGGT
ATCGAAAAGTTTGAGTTGCCCGACGCCTCGACCGGCTGGCTGGTCCTCGTGGCCGTTCTCGCCAACGCTACCTTT
AGCGGCTCGTTCCTGGTCCTCATCTCGTTGACGTCGCCTGTCTTATCGTCAGTCGCCGCCCTGCTGACCATCTTC
ATCGTCGCCCTGGCCGACTGGTTCCTCACGGGCCAACCCCTGAGCTGGGCTGCCATCATCGGCGGCTCCATGATC
ATCGTCGCCTTCCTCGGCCTGAGCTGGAGCACCTACCGCGAGATGACGGAGCACGAGGCCCGGAAGCTGTCCGTC
GACCTCACCGACAGCGAAGAGGACGCCGACCGTGCAGCTGCGGACGCTTAG
Transcript >Ophun1|4336
ATGGACGCCGACGGTAGCGGAGCCCACGAGGCCCGCGGCCCCGAAGCCGTCCCCGTCTCCTCTCCCGAACGTCAT
CCCGAGCCCGCCGGCATGCCGCTGCTGTACAAGCCCGAGACGGCCGAGTCCAACGGAGAGGCCGGCACCAGCCTC
CTGTGGCCCGACGACGATGACGGCGACGGTCGCCCTCCGCCCATGAGCCGCCGGTCGACAATGCGCAGCCGGAGC
CCCCTCGCCGCCGCCGCCGCCGCCCAGGCTCGCAAAAAGTACACCTACGCCGCCTTCTTCCTCGCCGTCAGCCTC
GTCACCTTTGCCATCCAGACGGAGCTCAGCGCCCATATACAGCACGATCTCGGCTGGGACAAGGCCTACTGCATG
ATGTACTTCACCCACGGCTCCTGGATCGTCCTGTGGCCCGCCATGCTGCTGGTCTTGCGCCTCCAGAAGCGTGAC
GAGCCGTGGCCCGTCTTCTGGCGCCGTCACAGGCAGATGCTGGCCTCGACCGTCGCAATGATTGAGCTGCAGACG
CTCGATGTCTTCACTCCGTCGGCCCAGCGCCGGGCTCGTCCCGCCATGTATCTGATCCGCACCACGGCCTTCATC
ACCTCGGCCCTGACTGTGGCCGGTCTCAGCTGGTACGTGGCCGTCAGCCTGACGACGCCCTCGGACCTGACGGCC
ATCTACAACTGCTCCGCCTTCTTCGCCTATGTCTTCTCCGTGCCCATCCTGCGCGAGCCTTTGCGCCTCGATAAG
TCGGTTGCCGTCTTCATCGCCATCGTCGGCGTCCTCATCGTCGCCTACGGAGACACGGGCGAGTCAGTCGGCAAG
GGCCATCAGCCCGGCGCTGGCAGCCGCTTCGTCGGCAATCTCGTCATTGGCATCGGCTCCGTCCTCTACGGCTTG
TACGAGGTGCTGTACAAGCGTTACGCCTGTCCGCCCGATGGCGTCTCCCCCGGACGCGGCACCATCTTCGCCAAC
ACATTCGGCGCCTGCATCGGCTTCTTCACTCTGACGGTTCTGTGGATCCCGCTGCCCATTCTGCACGTCCTGGGT
ATCGAAAAGTTTGAGTTGCCCGACGCCTCGACCGGCTGGCTGGTCCTCGTGGCCGTTCTCGCCAACGCTACCTTT
AGCGGCTCGTTCCTGGTCCTCATCTCGTTGACGTCGCCTGTCTTATCGTCAGTCGCCGCCCTGCTGACCATCTTC
ATCGTCGCCCTGGCCGACTGGTTCCTCACGGGCCAACCCCTGAGCTGGGCTGCCATCATCGGCGGCTCCATGATC
ATCGTCGCCTTCCTCGGCCTGAGCTGGAGCACCTACCGCGAGATGACGGAGCACGAGGCCCGGAAGCTGTCCGTC
GACCTCACCGACAGCGAAGAGGACGCCGACCGTGCAGCTGCGGACGCTTAG
Gene >Ophun1|4336
ATGGACGCCGACGGTAGCGGAGCCCACGAGGCCCGCGGCCCCGAAGCCGTCCCCGTCTCCTCTCCCGAACGTCAT
CCCGAGCCCGCCGGCATGCCGCTGCTGTACAAGCCCGAGACGGCCGAGTCCAACGGAGAGGCCGGCACCAGCCTC
CTGTGGCCCGACGACGATGACGGCGACGGTCGCCCTCCGCCCATGAGCCGCCGGTCGACAATGCGCAGCCGGAGC
CCCCTCGCCGCCGCCGCCGCCGCCCAGGCTCGCAAAAAGTACACCTACGCCGCCTTCTTCCTCGCCGTCAGCCTC
GTCACCTTTGCCATCCAGACGGAGCTCAGCGCCCATATACAGCACGATCTCGGCTGGGACAAGGCCTACTGCATG
ATGTACTTCACCCACGGCTCCTGGATCGTCCTGTGGCCCGCCATGCTGCTGGTCTTGCGCCTCCAGAAGCGTGAC
GAGCCGTGGCCCGTCTTCTGGCGCCGTCACAGGCAGATGCTGGCCTCGACCGTCGCAATGATTGAGCTGCAGACG
CTCGATGTCTTCACTCCGTCGGCCCAGCGCCGGGCTCGTCCCGCCATGTATCTGATCCGCACCACGGCCTTCATC
ACCTCGGCCCTGACTGTGGCCGGTCTCAGCTGGTACGTGGCCGTCAGCCTGACGACGCCCTCGGACCTGACGGCC
ATCTACAACTGCTCCGCCTTCTTCGCCTATGTCTTCTCCGTGCCCATCCTGCGCGAGCCTTTGCGCCTCGATAAG
TCGGTTGCCGTCTTCATCGCCATCGTCGGCGTCCTCATCGTCGCCTACGGAGACACGGGCGAGTCAGTCGGCAAG
GGCCATCAGCCCGGCGCTGGCAGCCGCTTCGTCGGCAATCTCGTCATTGGCATCGGCTCCGTCCTCTACGGCTTG
TACGAGGTGCTGTACAAGCGTTACGCCTGTCCGCCCGATGGCGTCTCCCCCGGACGCGGCACCATCTTCGCCAAC
ACATTCGGCGCCTGCATCGGCTTCTTCACTCTGACGGTTCTGTGGATCCCGCTGCCCATTCTGCACGTCCTGGGT
ATCGAAAAGTTTGAGTTGCCCGACGCCTCGACCGGCTGGCTGGTCCTCGTGGCCGTTCTCGCCAACGCTACCTTT
AGCGGCTCGTTCCTGGTCCTCATCTCGTTGACGTCGCCTGTCTTATCGTCAGTCGCCGCCCTGCTGACCATCTTC
ATCGTCGCCCTGGCCGACTGGTTCCTCACGGGCCAACCCCTGAGCTGGGCTGCCATCATCGGCGGCTCCATGATC
ATCGTCGCCTTCCTCGGCCTGAGCTGGAGCACCTACCGCGAGATGACGGAGCACGAGGCCCGGAAGCTGTCCGTC
GACCTCACCGACAGCGAAGAGGACGCCGACCGTGCAGCTGCGGACGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail