Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4325
Gene name
LocationContig_4:39947..43950
Strand-
Gene length (bp)4003
Transcript length (bp)3297
Coding sequence length (bp)3297
Protein length (aa) 1099

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 4.0E-83 349 731
PF06999 Suc_Fer-like Sucrase/ferredoxin-like 3.3E-22 792 1079

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 117 730 1.0E-158
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 187 735 2.0E-136
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 161 732 7.0E-124
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 318 697 2.0E-32
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 305 731 5.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 117 730 1.0E-158
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 187 735 2.0E-136
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 161 732 7.0E-124
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 318 697 2.0E-32
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 305 731 5.0E-30
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 342 725 7.0E-30
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 317 727 8.0E-28
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 348 697 4.0E-27
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 348 697 2.0E-26
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 341 725 2.0E-26
sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 340 727 5.0E-26
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 317 727 6.0E-26
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 332 709 5.0E-25
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 364 708 9.0E-24
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 327 697 9.0E-24
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 359 633 9.0E-24
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 342 633 3.0E-23
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 362 719 2.0E-20
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 346 732 2.0E-20
sp|P34479|SKAT1_CAEEL Probable amino acid transporter skat-1 OS=Caenorhabditis elegans GN=skat-1 PE=2 SV=2 320 709 3.0E-09
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 320 736 3.0E-09
sp|C4Y1G7|AIM32_CLAL4 Altered inheritance of mitochondria protein 32 OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM32 PE=3 SV=1 951 1082 3.0E-07
sp|A5DK49|AIM32_PICGU Altered inheritance of mitochondria protein 32 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=AIM32 PE=3 SV=2 945 1081 9.0E-07
sp|Q6BPT6|AIM32_DEBHA Altered inheritance of mitochondria protein 32 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM32 PE=3 SV=2 936 1081 3.0E-06
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 311 698 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 380 402 22
2 423 445 22
3 465 484 19
4 491 513 22
5 533 552 19
6 565 587 22
7 611 633 22
8 654 671 17
9 681 700 19
10 713 735 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4325
MSSPKNQMPSFGLSSSPAPGHARSFSTSIPRGELTARLAEPIHSGQRSASPAAGPVLPDVDSPLAGGRQQAQGPG
VSALAAALSDSLGKSPPRFGTPPARAASPPPRPTSPTLPLRTDTPTNYGSFDSRSRPCQGSAVGPYEDPEIVRRH
LVQPGESENLPSEESSTQGRGKQSVEPGAGLNDDEFSSLRLQGGDITRGIYKWTEQAGAKGRLHRSRSFDHQRPE
PEAEVLDISSIKVPGGFRRNHLRRNAMSPNRQAEADESGAESPPGTQPRLFTSSFLEFLTIYGHFAGEELEEDDE
ALGPDEEFWSDRAGPGDDSDDEREPMEDSALLTQSKRMRRRKPRGGSGKNSPMNAALLLLKSFVGTGVLFLPRAY
LSGGMLLSNLVLLCLAGLSYYSFVLLVSTRNNVEGSFGDMGGILYGKWMRTLILASIVISQIGFTAAYTVFTAEN
LQAFISAVSDCRTTISIPWLILLQTLIFLPFSLLRDIGKLGFTALIADAFILIGLAYLFYYDVLTLSKFGLADII
MFNDKDWTLFIGTAIFTFEGIGLVIPIQESMKHPQKFPRVLFYVMIIITVVFVTMGAISYAAYGSKTETVVLLNL
PQDNKLVNGVQLLYSVAILLSTPLQIFPAVRIVETELFTRSGKYNPYIKWQKNIFRFFVVMLCAAISWGGADNLD
KFVALVGNFACIPLVYIYPPLLHYRAVARNRAWKIADVVLCVFGFFAMAYATSLTIMSWANAGAKPPAARLIRPS
AAARWHQTKLPAVRLCPPPRYYIDGEGSKAKWFDVEHDGSPWETARPYREEVIICTGSREWSANPILENYGDTLF
ADVVAMMDNALRILGKRGPNLDPLSIVFNSSFSSSITKRNRKPHTSALFFPSFKYAPLIPRTTRDAKSRDETLKK
RFAVEALVERFLVNHMPVGRLTPISTADKEILRVEEHKRFNNMLQDVKDVFVLVCGHGGDCSEVGPLLMKEFKIE
LVQAGLDVRDDCFAPENDTPEAREDGVVPVQAARVGLMSHDGPRHMAGHVTIYLPPGMRLGRNGPPHPLAGLGVR
YGMVSLKNVEGLVLETVVRGRVVMEKFRGGVMPGGKPLTVEDLEQDAR*
Coding >Ophun1|4325
ATGTCCTCGCCCAAGAATCAGATGCCTTCCTTTGGGCTGTCATCGTCCCCAGCACCGGGACATGCCCGATCCTTT
TCCACCTCGATCCCGCGCGGGGAGCTCACCGCCCGCCTCGCCGAGCCCATCCATTCCGGGCAGCGCAGCGCATCG
CCAGCCGCCGGCCCGGTGCTTCCCGATGTCGACTCTCCCCTTGCCGGCGGCCGTCAGCAAGCTCAGGGCCCCGGC
GTTTCCGCTCTGGCGGCTGCCCTGTCCGATTCTCTCGGCAAGTCGCCACCGCGCTTCGGGACGCCTCCCGCGAGG
GCCGCCTCACCGCCGCCGCGACCGACGTCTCCCACACTCCCATTACGAACCGACACACCTACCAACTACGGCTCC
TTCGACTCGAGATCTCGCCCGTGTCAGGGTAGCGCAGTTGGGCCCTATGAAGACCCTGAAATTGTCAGGCGCCAT
CTGGTGCAGCCCGGCGAGTCGGAGAATCTGCCCTCGGAAGAGTCGTCCACGCAGGGGCGCGGGAAACAGTCGGTC
GAGCCCGGCGCCGGCCTCAACGATGACGAATTCTCCAGCTTGCGGCTCCAGGGCGGTGACATCACCCGGGGTATC
TATAAATGGACGGAACAGGCCGGGGCCAAGGGACGGCTCCATCGCAGCCGGAGCTTCGACCACCAACGGCCCGAA
CCGGAGGCGGAAGTCTTGGACATCAGCTCCATCAAGGTTCCGGGTGGCTTCCGGAGAAATCATCTTCGTCGAAAT
GCCATGAGTCCTAACCGGCAAGCCGAGGCTGATGAGTCTGGCGCCGAATCTCCGCCTGGGACCCAGCCGAGGCTC
TTCACATCGAGCTTCCTCGAATTCCTCACCATCTATGGCCATTTTGCGGGCGAGGAGCTCGAAGAAGACGACGAA
GCCCTCGGGCCCGATGAGGAGTTTTGGTCGGACCGAGCGGGACCCGGCGACGATAGCGACGATGAACGGGAGCCC
ATGGAGGATAGTGCACTCCTCACGCAGTCTAAGAGGATGCGGCGGCGCAAGCCACGCGGCGGCAGCGGCAAGAAT
AGCCCTATGAATGCGGCCCTCTTGCTGCTCAAGTCTTTTGTCGGCACCGGGGTGTTATTCCTCCCACGCGCCTAT
CTCAGCGGCGGCATGCTGCTCAGCAACCTGGTTCTGCTCTGCCTCGCCGGCTTGAGCTACTACAGTTTCGTGCTA
CTGGTTTCTACGCGGAATAACGTCGAGGGCTCCTTTGGCGACATGGGCGGAATCCTCTACGGCAAATGGATGCGA
ACACTGATTCTGGCGTCCATCGTCATCAGCCAGATCGGCTTCACCGCAGCCTATACCGTCTTTACCGCCGAGAAC
CTGCAAGCCTTTATCAGCGCCGTTTCCGACTGCCGTACGACAATCAGCATTCCGTGGCTGATCCTATTGCAAACA
CTCATTTTCCTTCCCTTTTCTTTACTTCGGGACATTGGCAAGCTGGGCTTCACAGCGCTCATTGCCGACGCCTTT
ATTCTTATCGGGCTGGCCTACCTCTTCTATTATGACGTGTTGACGCTCAGCAAGTTTGGACTCGCCGACATCATC
ATGTTCAACGACAAGGACTGGACCCTTTTCATCGGTACAGCCATCTTTACATTTGAGGGCATAGGCCTGGTCATT
CCCATCCAGGAGTCGATGAAACATCCGCAAAAGTTTCCCCGAGTGCTTTTCTATGTCATGATCATCATTACCGTC
GTCTTCGTTACTATGGGCGCCATCTCATACGCCGCGTACGGATCCAAGACAGAGACGGTGGTGCTTCTCAACTTA
CCGCAGGATAATAAACTGGTCAACGGTGTCCAACTGCTCTACTCGGTTGCCATCCTGCTATCGACGCCGCTTCAG
ATCTTTCCTGCCGTGCGCATCGTCGAGACGGAACTTTTCACGCGGAGCGGCAAATACAATCCTTACATCAAGTGG
CAGAAGAACATCTTTCGCTTCTTCGTCGTCATGCTGTGTGCCGCCATCTCGTGGGGTGGCGCCGATAATCTGGAC
AAGTTCGTGGCGCTGGTGGGCAACTTTGCCTGCATCCCGCTGGTCTATATCTATCCGCCGCTGCTGCACTACAGG
GCCGTGGCGAGAAACCGGGCGTGGAAAATTGCCGACGTGGTATTGTGCGTGTTTGGCTTCTTCGCCATGGCGTAC
GCCACCAGCCTGACCATCATGAGCTGGGCCAACGCCGGGGCCAAGCCGCCGGCGGCTCGCCTCATCCGCCCGTCG
GCGGCTGCCAGGTGGCACCAAACGAAGCTGCCGGCGGTCCGTCTGTGCCCGCCTCCCAGATATTACATCGACGGC
GAGGGGAGCAAGGCCAAGTGGTTCGACGTCGAGCACGATGGCTCCCCTTGGGAAACTGCGCGTCCGTACAGGGAG
GAGGTCATCATCTGCACTGGCTCCAGGGAATGGTCTGCGAACCCCATCCTGGAGAATTACGGGGATACTCTGTTC
GCCGATGTTGTGGCCATGATGGACAACGCGCTCAGAATCTTGGGCAAGCGCGGGCCGAACTTGGATCCGTTGTCA
ATCGTCTTCAACTCGTCGTTTTCGAGCTCGATTACCAAGAGAAACAGGAAGCCGCACACATCGGCTCTTTTCTTT
CCCAGCTTCAAGTACGCGCCACTGATACCACGGACGACGCGAGACGCCAAGAGTAGAGACGAGACGTTGAAAAAG
CGGTTCGCCGTCGAGGCTCTTGTCGAGAGATTCCTCGTCAACCACATGCCAGTCGGGAGACTCACCCCCATCTCA
ACCGCAGACAAGGAGATTCTGCGAGTCGAAGAGCACAAGCGGTTCAACAACATGCTGCAAGACGTCAAGGACGTT
TTTGTTCTCGTCTGCGGTCATGGTGGTGACTGCAGCGAGGTCGGTCCGCTGCTGATGAAGGAATTCAAAATCGAG
CTCGTGCAGGCGGGGCTCGATGTTCGCGACGATTGCTTCGCGCCGGAGAACGACACGCCAGAGGCGCGGGAGGAC
GGTGTAGTTCCGGTGCAGGCAGCTAGAGTCGGATTGATGAGCCATGACGGCCCGCGACACATGGCCGGCCACGTC
ACCATTTACCTCCCGCCTGGGATGCGGCTGGGAAGAAATGGCCCACCGCATCCCCTTGCAGGTCTCGGGGTTCGT
TACGGCATGGTATCGTTGAAGAACGTCGAGGGGCTGGTGCTGGAGACGGTCGTCCGGGGGAGAGTCGTGATGGAG
AAGTTCAGGGGGGGAGTCATGCCCGGGGGGAAACCGCTGACGGTGGAAGATCTGGAGCAGGACGCGAGGTGA
Transcript >Ophun1|4325
ATGTCCTCGCCCAAGAATCAGATGCCTTCCTTTGGGCTGTCATCGTCCCCAGCACCGGGACATGCCCGATCCTTT
TCCACCTCGATCCCGCGCGGGGAGCTCACCGCCCGCCTCGCCGAGCCCATCCATTCCGGGCAGCGCAGCGCATCG
CCAGCCGCCGGCCCGGTGCTTCCCGATGTCGACTCTCCCCTTGCCGGCGGCCGTCAGCAAGCTCAGGGCCCCGGC
GTTTCCGCTCTGGCGGCTGCCCTGTCCGATTCTCTCGGCAAGTCGCCACCGCGCTTCGGGACGCCTCCCGCGAGG
GCCGCCTCACCGCCGCCGCGACCGACGTCTCCCACACTCCCATTACGAACCGACACACCTACCAACTACGGCTCC
TTCGACTCGAGATCTCGCCCGTGTCAGGGTAGCGCAGTTGGGCCCTATGAAGACCCTGAAATTGTCAGGCGCCAT
CTGGTGCAGCCCGGCGAGTCGGAGAATCTGCCCTCGGAAGAGTCGTCCACGCAGGGGCGCGGGAAACAGTCGGTC
GAGCCCGGCGCCGGCCTCAACGATGACGAATTCTCCAGCTTGCGGCTCCAGGGCGGTGACATCACCCGGGGTATC
TATAAATGGACGGAACAGGCCGGGGCCAAGGGACGGCTCCATCGCAGCCGGAGCTTCGACCACCAACGGCCCGAA
CCGGAGGCGGAAGTCTTGGACATCAGCTCCATCAAGGTTCCGGGTGGCTTCCGGAGAAATCATCTTCGTCGAAAT
GCCATGAGTCCTAACCGGCAAGCCGAGGCTGATGAGTCTGGCGCCGAATCTCCGCCTGGGACCCAGCCGAGGCTC
TTCACATCGAGCTTCCTCGAATTCCTCACCATCTATGGCCATTTTGCGGGCGAGGAGCTCGAAGAAGACGACGAA
GCCCTCGGGCCCGATGAGGAGTTTTGGTCGGACCGAGCGGGACCCGGCGACGATAGCGACGATGAACGGGAGCCC
ATGGAGGATAGTGCACTCCTCACGCAGTCTAAGAGGATGCGGCGGCGCAAGCCACGCGGCGGCAGCGGCAAGAAT
AGCCCTATGAATGCGGCCCTCTTGCTGCTCAAGTCTTTTGTCGGCACCGGGGTGTTATTCCTCCCACGCGCCTAT
CTCAGCGGCGGCATGCTGCTCAGCAACCTGGTTCTGCTCTGCCTCGCCGGCTTGAGCTACTACAGTTTCGTGCTA
CTGGTTTCTACGCGGAATAACGTCGAGGGCTCCTTTGGCGACATGGGCGGAATCCTCTACGGCAAATGGATGCGA
ACACTGATTCTGGCGTCCATCGTCATCAGCCAGATCGGCTTCACCGCAGCCTATACCGTCTTTACCGCCGAGAAC
CTGCAAGCCTTTATCAGCGCCGTTTCCGACTGCCGTACGACAATCAGCATTCCGTGGCTGATCCTATTGCAAACA
CTCATTTTCCTTCCCTTTTCTTTACTTCGGGACATTGGCAAGCTGGGCTTCACAGCGCTCATTGCCGACGCCTTT
ATTCTTATCGGGCTGGCCTACCTCTTCTATTATGACGTGTTGACGCTCAGCAAGTTTGGACTCGCCGACATCATC
ATGTTCAACGACAAGGACTGGACCCTTTTCATCGGTACAGCCATCTTTACATTTGAGGGCATAGGCCTGGTCATT
CCCATCCAGGAGTCGATGAAACATCCGCAAAAGTTTCCCCGAGTGCTTTTCTATGTCATGATCATCATTACCGTC
GTCTTCGTTACTATGGGCGCCATCTCATACGCCGCGTACGGATCCAAGACAGAGACGGTGGTGCTTCTCAACTTA
CCGCAGGATAATAAACTGGTCAACGGTGTCCAACTGCTCTACTCGGTTGCCATCCTGCTATCGACGCCGCTTCAG
ATCTTTCCTGCCGTGCGCATCGTCGAGACGGAACTTTTCACGCGGAGCGGCAAATACAATCCTTACATCAAGTGG
CAGAAGAACATCTTTCGCTTCTTCGTCGTCATGCTGTGTGCCGCCATCTCGTGGGGTGGCGCCGATAATCTGGAC
AAGTTCGTGGCGCTGGTGGGCAACTTTGCCTGCATCCCGCTGGTCTATATCTATCCGCCGCTGCTGCACTACAGG
GCCGTGGCGAGAAACCGGGCGTGGAAAATTGCCGACGTGGTATTGTGCGTGTTTGGCTTCTTCGCCATGGCGTAC
GCCACCAGCCTGACCATCATGAGCTGGGCCAACGCCGGGGCCAAGCCGCCGGCGGCTCGCCTCATCCGCCCGTCG
GCGGCTGCCAGGTGGCACCAAACGAAGCTGCCGGCGGTCCGTCTGTGCCCGCCTCCCAGATATTACATCGACGGC
GAGGGGAGCAAGGCCAAGTGGTTCGACGTCGAGCACGATGGCTCCCCTTGGGAAACTGCGCGTCCGTACAGGGAG
GAGGTCATCATCTGCACTGGCTCCAGGGAATGGTCTGCGAACCCCATCCTGGAGAATTACGGGGATACTCTGTTC
GCCGATGTTGTGGCCATGATGGACAACGCGCTCAGAATCTTGGGCAAGCGCGGGCCGAACTTGGATCCGTTGTCA
ATCGTCTTCAACTCGTCGTTTTCGAGCTCGATTACCAAGAGAAACAGGAAGCCGCACACATCGGCTCTTTTCTTT
CCCAGCTTCAAGTACGCGCCACTGATACCACGGACGACGCGAGACGCCAAGAGTAGAGACGAGACGTTGAAAAAG
CGGTTCGCCGTCGAGGCTCTTGTCGAGAGATTCCTCGTCAACCACATGCCAGTCGGGAGACTCACCCCCATCTCA
ACCGCAGACAAGGAGATTCTGCGAGTCGAAGAGCACAAGCGGTTCAACAACATGCTGCAAGACGTCAAGGACGTT
TTTGTTCTCGTCTGCGGTCATGGTGGTGACTGCAGCGAGGTCGGTCCGCTGCTGATGAAGGAATTCAAAATCGAG
CTCGTGCAGGCGGGGCTCGATGTTCGCGACGATTGCTTCGCGCCGGAGAACGACACGCCAGAGGCGCGGGAGGAC
GGTGTAGTTCCGGTGCAGGCAGCTAGAGTCGGATTGATGAGCCATGACGGCCCGCGACACATGGCCGGCCACGTC
ACCATTTACCTCCCGCCTGGGATGCGGCTGGGAAGAAATGGCCCACCGCATCCCCTTGCAGGTCTCGGGGTTCGT
TACGGCATGGTATCGTTGAAGAACGTCGAGGGGCTGGTGCTGGAGACGGTCGTCCGGGGGAGAGTCGTGATGGAG
AAGTTCAGGGGGGGAGTCATGCCCGGGGGGAAACCGCTGACGGTGGAAGATCTGGAGCAGGACGCGAGGTGA
Gene >Ophun1|4325
ATGTCCTCGCCCAAGAATCAGATGCCTTCCTTTGGGCTGTCATCGTCCCCAGCACCGGGACATGCCCGATCCTTT
TCCACCTCGATCCCGCGCGGGGAGCTCACCGCCCGCCTCGCCGAGCCCATCCATTCCGGGCAGCGCAGCGCATCG
CCAGCCGCCGGCCCGGTGCTTCCCGATGTCGACTCTCCCCTTGCCGGCGGCCGTCAGCAAGCTCAGGGCCCCGGC
GTTTCCGCTCTGGCGGCTGCCCTGTCCGATTCTCTCGGCAAGTCGCCACCGCGCTTCGGGACGCCTCCCGCGAGG
GCCGCCTCACCGCCGCCGCGACCGACGTCTCCCACACTCCCATTACGAACCGACACACCTACCAACTACGGCTCC
TTCGACTCGAGATCTCGCCCGTGTCAGGGTAGCGCAGTTGGGCCCTATGAAGACCCTGAAATTGTCAGGCGCCAT
CTGGTGCAGCCCGGCGAGTCGGAGAATCTGCCCTCGGAAGAGTCGTCCACGCAGGGGCGCGGGAAACAGTCGGTC
GAGCCCGGCGCCGGCCTCAACGATGACGAATTCTCCAGCTTGCGGCTCCAGGGCGGTGACATCACCCGGGGTATC
TATAAATGGACGGAACAGGCCGGGGCCAAGGGACGGCTCCATCGCAGCCGGAGCTTCGACCACCAACGGCCCGAA
CCGGAGGCGGAAGTCTTGGACATCAGCTCCATCAAGGTTCCGGGTGGCTTCCGGAGAAATCATCTTCGTCGAAAT
GCCATGAGTCCTAACCGGCAAGCCGAGGCTGATGAGTCTGGCGCCGAATCTCCGCCTGGGACCCAGCCGAGGCTC
TTCACATCGAGCTTCCTCGAATTCCTCACCATCTATGGCCATTTTGCGGGCGAGGAGCTCGAAGAAGACGACGAA
GCCCTCGGGCCCGATGAGGAGTTTTGGTCGGACCGAGCGGGACCCGGCGACGATAGCGACGATGAACGGGAGCCC
ATGGAGGATAGTGCACTCCTCACGCAGTCTAAGAGGATGCGGCGGCGCAAGCCACGCGGCGGCAGCGGCAAGAAT
AGCCCTATGAATGCGGCCCTCTTGCTGCTCAAGTCTTTTGTCGGCACCGGGGTGTTATTCCTCCCACGCGCCTAT
CTCAGCGGCGGCATGCTGCTCAGCAACCTGGTTCTGCTCTGCCTCGCCGGCTTGAGCTACTACAGTTTCGTGCTA
CTGGTTTCTACGCGGAATAACGTCGAGGGCTCCTTTGGCGACATGGGCGGAATCCTCTACGGCAAATGGATGCGA
ACACTGATTCTGGCGTCCATCGTCATCAGCCAGATCGGCTTCACCGCAGCCTATACCGTCTTTACCGCCGAGAAC
CTGCAAGCCTTTATCAGCGCCGTTTCCGACTGCCGTACGACAATCAGCATTCCGTGGCTGATCCTATTGCAAACA
CTCATTTTCCTTCCCTTTTCTTTACTTCGGGACATTGGCAAGCTGGGCTTCACAGCGCTCATTGCCGACGCCTTT
ATTCTTATCGGGCTGGCCTACCTCTTCTATTATGACGTGTTGACGCTCAGCAAGTTTGGACTCGCCGACATCATC
ATGTTCAACGACAAGGACTGGACCCTTTTCATCGGTACAGCCATCTTTACATTTGAGGGCATAGGCCTGGTCATT
CCCATCCAGGAGTCGATGAAACATCCGCAAAAGTTTCCCCGAGTGCTTTTCTATGTCATGATCATCATTACCGTC
GTCTTCGTTACTATGGGCGCCATCTCATACGCCGCGTACGGATCCAAGACAGAGACGGTGGTGCTTCTCAACTTA
CCGCAGGATAATAAACTGGTCAACGGTGTCCAACTGCTCTACTCGGTTGCCATCCTGCTATCGACGCCGCTTCAG
ATCTTTCCTGCCGTGCGCATCGTCGAGACGGAACTTTTCACGCGGAGCGGCAAATACAATCCTTACATCAAGTGG
CAGAAGAACATCTTTCGCTTCTTCGTCGTCATGCTGTGTGCCGCCATCTCGTGGGGTGGCGCCGATAATCTGGAC
AAGTTCGTGGCGCTGGTGGGCAACTTTGCCTGCATCCCGCTGGTCTATATCTATCCGGTAAGGACGCTCATAGGA
CGCCCATAGCCAGCAAGGCGAGGGTCGGCGCTAACATGCACGTCAGCCGCTGCTGCACTACAGGGCCGTGGCGAG
AAACCGGGCGTGGAAAATTGCCGACGTGGTATTGTGCGTGTTTGGCTTCTTCGCCATGGCGTACGCCACCAGCCT
GACCATCATGAGCTGGGCCAACGCCGGGGCCAAGCCGCCGGGTTACTGCGAGAGGAGGCACCTATAAGATACACG
AGCATTGCGGAAACGACATGGAGTCTTTCTTTTGAAGACAGCCTTCATTGGAAATACCTGCGGTCACTCGGGCTT
CGTTCACCGAGATGGCCTTCTTGCGGCCTGCCTTGGTACGAAGACACACGAGGCAGCATCTGGCGACACTATTTA
TATTACCAGAACTTTTTCTCACAGAACCAGCGTTATCTTTACGATGGCATCATACCAGGGCGCCGCTTACACGGC
TGTGTGAAAGCGATGGAGGAGGAAGAGGGAAGCATAGGATGCGCCAGGAGGTGGCGACTCAGCGGCTAGGAGGTA
GCGTGTCGTTTTGTACTTTGACAAGAGACTTGCTTGACCTACTTCGATGCCATTCTTCCGTCTTGAGTTTCGGAT
GACGTTGGTTGAATGCTGAGAGAATGCTGAGAGAATGCTGAGAGTGAGGCGGTAGACCGGCTTGACCGCCTTCCT
ATCGCGTAATTCTGCCGTCCGCGAAAACGACGGCCGAAATCTTGCAGATCAGAGGTCTCAGCATTGCTGAGGCAT
GTTTTCCGTCCCTGCGGCCTCTCGTCTGCCAGCGGCTCGCCTCATCCGCCCGTCGGCGGCTGCCAGGTGGCACCA
AACGAAGCTGCCGGCGGTCCGTCTGTGCCCGCCTCCCAGATATTACATCGACGGCGAGGGGAGCAAGGCCAAGTG
GTTCGACGTCGAGCACGATGGCTCCCCTTGGGAAACTGCGCGTCCGTACAGGGAGGAGGTCATCATCTGCACTGG
CTCCAGGGAATGGTCTGCGAACCCCATCCTGGAGAATTACGGGGATACTCTGTTCGCCGATGTTGTGGCCATGAT
GGACAACGCGCTCAGAATCTTGGGCAAGCGCGGGCCGGTACGTTGTCGACTCTCATATTATCCAGTACAAGCGCT
CACGTCTTTCTAGAACTTGGATCCGTTGTCAATCGTCTTCAACTCGTCGTTTTCGAGCTCGATTACCAAGAGAAA
CAGGAAGCCGCACACATCGGCTCTTTTCTTTCCCAGCTTCAAGTACGCGCCACTGATACCACGGACGACGCGAGA
CGCCAAGAGTAGAGACGAGACGTTGAAAAAGCGGTTCGCCGTCGAGGCTCTTGTCGAGAGATTCCTCGTCAACCA
CATGCCAGTCGGGAGACTCACCCCCATCTCAACCGCAGACAAGGAGATTCTGCGAGTCGAAGAGCACAAGCGGTT
CAACAACATGCTGCAAGACGTCAAGGACGTTTTTGTTCTCGTCTGCGGTCATGGTGGTGACTGCAGCGAGGTCGG
TCCGCTGCTGATGAAGGAATTCAAAATCGAGCTCGTGCAGGCGGGGCTCGATGTTCGCGACGATTGCTTCGCGCC
GGAGAACGACACGCCAGAGGCGCGGGAGGACGGTGTAGTTCCGGTGCAGGCAGCTAGAGTCGGATTGATGAGCCA
TGACGGCCCGCGACACATGGCCGGCCACGTCACCATTTACCTCCCGCCTGGGATGCGGCTGGGAAGAAATGGCCC
ACCGCATCCCCTTGCAGGTCTCGGGGTTCGTTACGGCATGGTATCGTTGAAGAACGTCGAGGGGCTGGTGCTGGA
GACGGTCGTCCGGGGGAGAGTCGTGATGGAGAAGTTCAGGGGGGGAGTCATGCCCGGGGGGAAACCGCTGACGGT
GGAAGATCTGGAGCAGGACGCGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail