Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|432
Gene name
LocationContig_112:15981..17538
Strand+
Gene length (bp)1557
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-48 55 461
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 8.7E-08 70 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 2 486 3.0E-69
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 3 482 2.0E-68
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 11 513 9.0E-61
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 38 503 6.0E-59
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 38 489 3.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 2 486 3.0E-69
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 3 482 2.0E-68
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 11 513 9.0E-61
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 38 503 6.0E-59
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 38 489 3.0E-49
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 38 508 2.0E-41
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 30 231 2.0E-31
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 47 262 6.0E-29
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 24 512 4.0E-26
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 72 507 4.0E-25
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 24 511 2.0E-23
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 45 508 1.0E-22
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 58 490 4.0E-22
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 6 513 5.0E-22
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 67 506 1.0E-21
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 67 506 1.0E-21
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 56 365 3.0E-21
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 46 510 6.0E-21
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 24 511 8.0E-21
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 101 478 9.0E-21
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 88 478 2.0E-20
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 44 505 2.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 6 511 3.0E-20
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 67 227 6.0E-19
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 3 507 8.0E-19
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 1 505 1.0E-18
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 1 513 1.0E-18
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 67 508 3.0E-17
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 67 508 3.0E-17
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 43 211 2.0E-16
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 67 508 4.0E-16
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 283 511 5.0E-15
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 88 511 5.0E-14
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 49 493 5.0E-14
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 62 401 4.0E-12
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 88 508 9.0E-12
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 67 227 1.0E-11
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 67 227 1.0E-11
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 47 207 2.0E-11
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 67 227 2.0E-11
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 67 227 3.0E-11
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 67 227 4.0E-11
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 67 227 4.0E-11
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 67 227 5.0E-11
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 67 227 5.0E-11
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 67 227 6.0E-11
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 67 239 6.0E-11
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 67 227 6.0E-11
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 67 227 6.0E-11
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 67 227 6.0E-11
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 67 227 8.0E-11
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 67 227 8.0E-11
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 67 227 8.0E-11
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 67 259 8.0E-11
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 67 227 9.0E-11
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 67 227 1.0E-10
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 3 513 2.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 47 209 4.0E-10
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 63 358 5.0E-10
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 67 245 6.0E-10
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 67 224 1.0E-09
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 283 486 2.0E-09
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 67 259 2.0E-09
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 101 508 3.0E-09
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 67 207 3.0E-09
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 71 220 3.0E-09
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 46 212 4.0E-09
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 67 245 4.0E-09
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 67 245 4.0E-09
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 34 367 5.0E-09
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 67 229 5.0E-09
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 67 229 5.0E-09
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 67 229 5.0E-09
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 67 245 5.0E-09
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 67 229 6.0E-09
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 67 229 7.0E-09
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 67 229 7.0E-09
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 67 229 8.0E-09
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 62 254 8.0E-09
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 43 367 8.0E-09
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 67 227 9.0E-09
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 67 229 1.0E-08
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 69 346 1.0E-08
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 43 367 1.0E-08
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 43 367 1.0E-08
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 43 367 2.0E-08
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 43 367 2.0E-08
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 43 367 2.0E-08
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 67 245 2.0E-08
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 67 245 2.0E-08
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 43 367 2.0E-08
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 45 207 3.0E-08
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 90 510 3.0E-08
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 34 367 3.0E-08
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 43 206 4.0E-08
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 43 206 4.0E-08
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 43 367 5.0E-08
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 67 211 7.0E-08
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 43 206 9.0E-08
sp|P77726|YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) GN=yajR PE=1 SV=2 69 236 2.0E-07
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 67 227 2.0E-07
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 43 358 2.0E-07
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 61 231 2.0E-07
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 53 224 3.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 2 510 4.0E-07
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 61 231 4.0E-07
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 88 510 5.0E-07
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 45 206 1.0E-06
sp|Q8EA87|MDTL_SHEON Multidrug resistance protein MdtL OS=Shewanella oneidensis (strain MR-1) GN=mdtL PE=3 SV=1 67 227 1.0E-06
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 112 227 1.0E-06
sp|D5B5U5|MDFA_YERPZ Multidrug transporter MdfA OS=Yersinia pestis (strain Z176003) GN=mdfA PE=3 SV=2 70 268 2.0E-06
sp|A9R4E0|MDFA_YERPG Multidrug transporter MdfA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdfA PE=3 SV=2 70 268 2.0E-06
sp|D0JKF6|MDFA_YERPD Multidrug transporter MdfA OS=Yersinia pestis (strain D106004) GN=mdfA PE=3 SV=2 70 268 2.0E-06
sp|D0JUX5|MDFA_YERP1 Multidrug transporter MdfA OS=Yersinia pestis (strain D182038) GN=mdfA PE=3 SV=2 70 268 2.0E-06
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 103 224 4.0E-06
sp|Q0GQS6|PBUE_BACAM Purine efflux pump PbuE OS=Bacillus amyloliquefaciens GN=pbuE PE=1 SV=1 72 226 4.0E-06
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 43 202 6.0E-06
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 43 202 8.0E-06
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 43 202 8.0E-06
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 43 202 8.0E-06
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 43 202 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 86 108 22
3 115 134 19
4 149 166 17
5 173 195 22
6 205 224 19
7 295 317 22
8 332 354 22
9 387 406 19
10 410 432 22
11 453 475 22
12 479 501 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|432
MSELREKNDKEGRLSSALPSDGGDAEGQPLAPILTGPPYSVFTTWQKRAIALGAALAAFFSPLTAMVFLPALTAI
AGDLGVTIAEVNLTITTYMVFQGITPMFIGSLADSGGRRPAYVVCFVIYIAANVGLALAPNYGALLALRCLQSAG
SSSTVALCTAVVADVVTSAERGQYVGFTLVPAVLAPALGPVIGGLLSQFLGWRSIFWFLAISSGATVVLIILFFP
ETCRHIVGDGSLQPPAMYRSVWQALRSRRKATSTNAKRDSSLPEIGKSQFKFRVPNILGSLFMLFEKETAVLLWA
SSLVFAGFYSVASAIPVLFTERYGFDEIKVGLMYLPVAVGSIGAACIVGPLINWNFRRHCAKLGLACDGKRQQDL
SQFPIERARLEVGFPLLAVAGASIIGWGWAIQARAHVAVPCVISVGLGIGIIGFNNTSNVLLVDMYPGRAGTATA
ANNLTRCLVGAGASAAIVPMINAMGVGWAFTLAGGLLLLCLPAIVLIVSYGQKWRSEQALKTQGRLGL*
Coding >Ophun1|432
ATGTCTGAGTTGCGCGAAAAGAATGACAAGGAGGGCCGTCTTTCATCAGCCCTTCCCAGCGACGGTGGCGATGCA
GAAGGCCAGCCTCTTGCGCCGATACTGACCGGACCCCCTTACTCCGTCTTCACCACATGGCAGAAGCGCGCCATA
GCCCTCGGGGCGGCCCTGGCGGCCTTTTTCTCACCACTGACGGCCATGGTCTTTCTACCAGCCCTGACAGCCATT
GCTGGCGATCTGGGCGTCACCATCGCCGAGGTCAACCTCACCATCACGACCTACATGGTCTTTCAGGGCATCACA
CCCATGTTCATCGGCTCGCTGGCTGACAGTGGCGGTCGGCGGCCGGCTTACGTCGTCTGTTTTGTCATTTACATT
GCTGCCAACGTCGGTCTCGCCCTGGCTCCCAACTACGGAGCTCTCCTGGCCCTGCGCTGTCTGCAGTCGGCCGGT
TCGAGCAGCACCGTTGCTCTATGCACGGCCGTCGTGGCCGACGTCGTCACCTCGGCTGAACGAGGGCAATATGTT
GGCTTCACGCTCGTTCCCGCTGTCCTCGCGCCCGCTCTAGGCCCCGTCATCGGCGGTCTTCTCTCGCAATTTCTC
GGCTGGAGATCCATATTCTGGTTCCTGGCCATTTCATCTGGAGCAACCGTCGTTCTCATCATCCTCTTTTTCCCG
GAGACTTGCAGACACATTGTCGGGGACGGATCTCTCCAGCCGCCGGCTATGTATCGTAGCGTGTGGCAAGCGCTG
AGAAGCCGGCGCAAGGCGACCAGCACCAATGCGAAGCGAGACTCGTCTCTCCCAGAGATAGGGAAGAGCCAGTTC
AAGTTCCGAGTGCCCAATATCCTGGGGTCTCTATTCATGCTCTTCGAGAAGGAGACGGCCGTCCTCCTCTGGGCA
AGCAGCCTCGTGTTTGCGGGCTTTTACTCCGTCGCCTCGGCTATTCCCGTTCTCTTTACCGAGCGATATGGCTTC
GACGAGATCAAGGTCGGCTTGATGTATTTACCCGTGGCCGTTGGATCCATCGGCGCCGCCTGCATCGTCGGACCC
CTGATCAACTGGAATTTCCGGCGACACTGCGCCAAGCTGGGGTTGGCGTGCGACGGCAAGCGGCAGCAGGACCTG
TCACAGTTCCCCATTGAGAGGGCCCGTCTGGAAGTTGGATTCCCGCTGCTGGCCGTGGCCGGGGCGAGCATCATC
GGCTGGGGCTGGGCGATACAGGCGCGGGCTCACGTCGCGGTTCCTTGCGTCATCAGCGTCGGTTTGGGTATCGGC
ATCATTGGCTTCAACAACACGAGCAACGTTCTGCTCGTCGACATGTATCCCGGAAGGGCCGGGACTGCGACGGCG
GCCAACAACTTGACTCGTTGCCTCGTTGGCGCGGGAGCGAGCGCCGCCATCGTACCCATGATCAACGCCATGGGC
GTGGGTTGGGCCTTTACTCTTGCTGGGGGGCTGCTTCTTTTATGCTTACCTGCTATCGTGCTCATCGTCTCATAC
GGGCAGAAGTGGCGAAGCGAGCAGGCTTTAAAGACTCAGGGGCGGCTAGGATTGTGA
Transcript >Ophun1|432
ATGTCTGAGTTGCGCGAAAAGAATGACAAGGAGGGCCGTCTTTCATCAGCCCTTCCCAGCGACGGTGGCGATGCA
GAAGGCCAGCCTCTTGCGCCGATACTGACCGGACCCCCTTACTCCGTCTTCACCACATGGCAGAAGCGCGCCATA
GCCCTCGGGGCGGCCCTGGCGGCCTTTTTCTCACCACTGACGGCCATGGTCTTTCTACCAGCCCTGACAGCCATT
GCTGGCGATCTGGGCGTCACCATCGCCGAGGTCAACCTCACCATCACGACCTACATGGTCTTTCAGGGCATCACA
CCCATGTTCATCGGCTCGCTGGCTGACAGTGGCGGTCGGCGGCCGGCTTACGTCGTCTGTTTTGTCATTTACATT
GCTGCCAACGTCGGTCTCGCCCTGGCTCCCAACTACGGAGCTCTCCTGGCCCTGCGCTGTCTGCAGTCGGCCGGT
TCGAGCAGCACCGTTGCTCTATGCACGGCCGTCGTGGCCGACGTCGTCACCTCGGCTGAACGAGGGCAATATGTT
GGCTTCACGCTCGTTCCCGCTGTCCTCGCGCCCGCTCTAGGCCCCGTCATCGGCGGTCTTCTCTCGCAATTTCTC
GGCTGGAGATCCATATTCTGGTTCCTGGCCATTTCATCTGGAGCAACCGTCGTTCTCATCATCCTCTTTTTCCCG
GAGACTTGCAGACACATTGTCGGGGACGGATCTCTCCAGCCGCCGGCTATGTATCGTAGCGTGTGGCAAGCGCTG
AGAAGCCGGCGCAAGGCGACCAGCACCAATGCGAAGCGAGACTCGTCTCTCCCAGAGATAGGGAAGAGCCAGTTC
AAGTTCCGAGTGCCCAATATCCTGGGGTCTCTATTCATGCTCTTCGAGAAGGAGACGGCCGTCCTCCTCTGGGCA
AGCAGCCTCGTGTTTGCGGGCTTTTACTCCGTCGCCTCGGCTATTCCCGTTCTCTTTACCGAGCGATATGGCTTC
GACGAGATCAAGGTCGGCTTGATGTATTTACCCGTGGCCGTTGGATCCATCGGCGCCGCCTGCATCGTCGGACCC
CTGATCAACTGGAATTTCCGGCGACACTGCGCCAAGCTGGGGTTGGCGTGCGACGGCAAGCGGCAGCAGGACCTG
TCACAGTTCCCCATTGAGAGGGCCCGTCTGGAAGTTGGATTCCCGCTGCTGGCCGTGGCCGGGGCGAGCATCATC
GGCTGGGGCTGGGCGATACAGGCGCGGGCTCACGTCGCGGTTCCTTGCGTCATCAGCGTCGGTTTGGGTATCGGC
ATCATTGGCTTCAACAACACGAGCAACGTTCTGCTCGTCGACATGTATCCCGGAAGGGCCGGGACTGCGACGGCG
GCCAACAACTTGACTCGTTGCCTCGTTGGCGCGGGAGCGAGCGCCGCCATCGTACCCATGATCAACGCCATGGGC
GTGGGTTGGGCCTTTACTCTTGCTGGGGGGCTGCTTCTTTTATGCTTACCTGCTATCGTGCTCATCGTCTCATAC
GGGCAGAAGTGGCGAAGCGAGCAGGCTTTAAAGACTCAGGGGCGGCTAGGATTGTGA
Gene >Ophun1|432
ATGTCTGAGTTGCGCGAAAAGAATGACAAGGAGGGCCGTCTTTCATCAGCCCTTCCCAGCGACGGTGGCGATGCA
GAAGGCCAGCCTCTTGCGCCGATACTGACCGGACCCCCTTACTCCGTCTTCACCACATGGCAGAAGCGCGCCATA
GCCCTCGGGGCGGCCCTGGCGGCCTTTTTCTCACCACTGACGGCCATGGTCTTTCTACCAGCCCTGACAGCCATT
GCTGGCGATCTGGGCGTCACCATCGCCGAGGTCAACCTCACCATCACGACCTACATGGTCTTTCAGGGCATCACA
CCCATGTTCATCGGCTCGCTGGCTGACAGTGGCGGTCGGCGGCCGGCTTACGTCGTCTGTTTTGTCATTTACATT
GCTGCCAACGTCGGTCTCGCCCTGGCTCCCAACTACGGAGCTCTCCTGGCCCTGCGCTGTCTGCAGTCGGCCGGT
TCGAGCAGCACCGTTGCTCTATGCACGGCCGTCGTGGCCGACGTCGTCACCTCGGCTGAACGAGGGCAATATGTT
GGCTTCACGCTCGTTCCCGCTGTCCTCGCGCCCGCTCTAGGCCCCGTCATCGGCGGTCTTCTCTCGCAATTTCTC
GGCTGGAGATCCATATTCTGGTTCCTGGCCATTTCATCTGGAGCAACCGTCGTTCTCATCATCCTCTTTTTCCCG
GAGACTTGCAGACACATTGTCGGGGACGGATCTCTCCAGCCGCCGGCTATGTATCGTAGCGTGTGGCAAGCGCTG
AGAAGCCGGCGCAAGGCGACCAGCACCAATGCGAAGCGAGACTCGTCTCTCCCAGAGATAGGGAAGAGCCAGTTC
AAGTTCCGAGTGCCCAATATCCTGGGGTCTCTATTCATGCTCTTCGAGAAGGAGACGGCCGTCCTCCTCTGGGCA
AGCAGCCTCGTGTTTGCGGGCTTTTACTCCGTCGCCTCGGCTATTCCCGTTCTCTTTACCGAGCGATATGGCTTC
GACGAGATCAAGGTCGGCTTGATGTATTTACCCGTGGCCGTTGGATCCATCGGCGCCGCCTGCATCGTCGGACCC
CTGATCAACTGGAATTTCCGGCGACACTGCGCCAAGCTGGGGTTGGCGTGCGACGGCAAGCGGCAGCAGGACCTG
TCACAGTTCCCCATTGAGAGGGCCCGTCTGGAAGTTGGATTCCCGCTGCTGGCCGTGGCCGGGGCGAGCATCATC
GGCTGGGGCTGGGCGATACAGGCGCGGGCTCACGTCGCGGTTCCTTGCGTCATCAGCGTCGGTTTGGGTATCGGC
ATCATTGGCTTCAACAACACGAGCAACGTTCTGCTCGTCGACATGTATCCCGGAAGGGCCGGGACTGCGACGGCG
GCCAACAACTTGACTCGTTGCCTCGTTGGCGCGGGAGCGAGCGCCGCCATCGTACCCATGATCAACGCCATGGGC
GTGGGTTGGGCCTTTACTCTTGCTGGGGGGCTGCTTCTTTTATGCTTACCTGCTATCGTGCTCATCGTCTCATAC
GGGCAGAAGTGGCGAAGCGAGCAGGCTTTAAAGACTCAGGGGCGGCTAGGATTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail