Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4316
Gene name
LocationContig_4:13655..17492
Strand-
Gene length (bp)3837
Transcript length (bp)3759
Coding sequence length (bp)3759
Protein length (aa) 1253

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 2.1E-51 1016 1243
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 2.7E-15 143 193
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.4E-06 585 892
PF13246 Cation_ATPase Cation transport ATPase (P-type) 5.5E-05 667 777

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 131 1250 0.0E+00
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 144 1250 0.0E+00
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 134 1251 0.0E+00
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 134 1251 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 133 1251 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 131 1250 0.0E+00
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 144 1250 0.0E+00
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 134 1251 0.0E+00
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 134 1251 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 133 1251 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 133 1251 0.0E+00
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 125 1251 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 125 1251 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 133 1251 0.0E+00
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 149 1250 5.0E-120
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 110 1239 1.0E-116
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 110 1239 8.0E-116
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 110 1239 1.0E-113
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 142 1204 1.0E-111
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 133 1129 1.0E-111
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 123 1250 1.0E-111
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 133 1129 2.0E-111
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 133 1129 5.0E-111
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 57 1250 4.0E-109
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 146 1247 1.0E-108
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 145 1250 8.0E-108
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 146 1250 4.0E-105
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 140 1250 6.0E-105
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 142 1133 4.0E-104
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 83 1197 2.0E-103
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 145 1250 2.0E-102
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 145 1250 1.0E-101
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 145 1243 2.0E-101
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 145 1243 8.0E-101
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 131 1250 8.0E-101
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 146 1236 1.0E-100
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 124 1243 4.0E-100
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 146 1142 6.0E-100
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 146 1232 2.0E-99
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 145 1208 4.0E-99
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 133 1252 7.0E-99
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 140 1179 1.0E-98
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 146 1246 2.0E-98
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 142 1197 3.0E-97
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 131 1250 8.0E-97
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 146 1146 1.0E-96
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 142 1197 9.0E-96
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 133 1251 6.0E-95
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 132 1204 6.0E-94
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 115 1204 2.0E-93
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 145 1167 4.0E-92
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 146 1228 2.0E-88
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 146 1138 4.0E-85
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 137 1189 4.0E-80
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 685 1138 1.0E-68
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 686 1193 3.0E-65
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 686 1138 2.0E-61
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 686 1195 3.0E-61
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 686 1180 7.0E-60
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 686 1132 1.0E-59
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 794 1217 7.0E-53
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 789 1243 9.0E-48
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 149 611 1.0E-34
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 296 777 2.0E-30
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 145 614 1.0E-24
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 149 615 2.0E-24
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 143 615 1.0E-23
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 82 614 9.0E-21
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 145 614 4.0E-19
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 569 1072 2.0E-18
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 541 1173 6.0E-16
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 570 1049 6.0E-16
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 569 1194 2.0E-15
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 569 1237 1.0E-14
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 569 1234 1.0E-14
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 520 1138 2.0E-14
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 534 1056 8.0E-14
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 530 1240 1.0E-13
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 490 1052 2.0E-13
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 490 1049 4.0E-13
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 729 1030 1.0E-12
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 473 1049 6.0E-12
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 727 1021 4.0E-11
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 845 1049 4.0E-11
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 845 1049 5.0E-11
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 490 1066 1.0E-10
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 490 1066 2.0E-10
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 490 1066 2.0E-10
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 731 1030 3.0E-10
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 569 1140 3.0E-10
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 569 1139 3.0E-10
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 569 1072 4.0E-10
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 794 1049 1.0E-09
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 541 1139 2.0E-08
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 736 1021 6.0E-08
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 771 1020 7.0E-08
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 465 1008 8.0E-08
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 771 1020 8.0E-08
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 726 1021 4.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 160 182 22
2 189 211 22
3 1079 1098 19
4 1123 1142 19
5 1157 1176 19
6 1183 1205 22
7 1215 1237 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1669
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1351
Ophiocordyceps australis map64 (Brazil) OphauB2|6026
Ophiocordyceps camponoti-floridani Ophcf2|05366
Ophiocordyceps camponoti-rufipedis Ophun1|4316 (this protein)
Ophiocordyceps kimflemingae Ophio5|8261
Ophiocordyceps subramaniannii Hirsu2|1419

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4316
MGGMPPSPPFRAPDSPTHDSDSDLDLDPDLDLGLDDLDPVSPTRHRPPEQSAPRIALRNLRMGSLRRAQKRGRAY
GQLGTPRDDTADTDSGNDDAPLLGGDQWVQPPRRESRVRLPGFMTDNDGARQHDASASRTVVVGGTQATRFPANL
VSNAKYTALTFLPVTLYNEFSFFFNMYFLLVALSQAIPALRIGYLSTYVAPLAFVLLITMGKEAYDDIARRRRDT
EANSEPYRVLTFDDAESNAASLRQRRPLKSDTVRRGSRRARRHDLSAIQEEDDDVDAVPSSHVQEVSRKSKDLKV
GQVLKLSKGQRVPADVVILQCCASDGCTSREPAAEEALLASAEDGSASKGKQPALMHELEAGNVGETFIRTDQLD
GETDWKLRLATPLTQNLPVEEFVRLRVTGGKPDKSVNEFVGTLELLPPQRQVSSSQEAEQSDEAAKSWALSIDNT
AWANTVIASQGTTLAVILYTGPETRSALSTAPSRSKTGLLEYEINSLTKILCALTLALSIVLVALQGFEKTGGNA
WYIKMMRFLVLFSTIVPISLRVNLDLGKSAYSRFIQHDPGIPGAVVRTSTIPEDLGRIEYLLSDKTGTLTQNDME
MKKIHVGTVSYANEAMDEVAAYVKQGFAVDAYPMLVTPSSSIGNVGTSRTRRDIASRVRDVVLALALCHNVTPTV
DSEDGRQVTSYQASSPDEIAIVKWAESVGLRLASRDRKSMTLQSTDSGRIVVRVRILDVFPFTSDGKRMGIIVHF
QEKVDAPSTDLGSGDIWFYQKGADTVMSSIVASNDWLDEETANMAREGLRTLVVGRKKLSAQQYSEFSSRHHEAS
LSLSGRDTGMQTVVSRYLETDLELLGVTGVEDKLQRDVKPSLELLRNAGIKIWMLTGDKVETARCVAVSSKLVAR
GQYIQTMARLKKKDYARDQLDVLRSKMDACLLIDGESLALLLTHFRLDFISMAVQLPTVVACRCSPTQKAEVAKL
IKEYTKKRVCCIGDGGNDVSMIQAADVGVGIVGKEGRQASLAADFSIEQFCHLVKLLVWHGRNSYKRSAKLAQFV
IHRGLIIAVCQTMYSIALGFEPEGLYKDWLLVGYATVYTAAPVLSLVLDRDVDEDVANLYPELYKELTSGRSLSY
RTFFVWVLVSVYQGGMIQGLSQLLTQVNGPKMVAVSYTVLVLNELIMVAIEITTWHPVMIISILGTFVAFVGSIP
FLGGYFDLKFIVTLGFFWRIFAIGAISLVPPYAGKLIRRAIKPPSYRKVQSR*
Coding >Ophun1|4316
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGCGCCCGATTCGCCAACGCACGACTCCGACTCGGATCTTGAC
CTCGATCCGGACCTTGATCTCGGCCTTGACGACCTCGATCCCGTCTCGCCGACCCGCCATCGTCCGCCCGAGCAG
TCGGCGCCGCGGATCGCGCTGAGGAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGATACCGACAGCGGCAATGACGATGCGCCCCTGCTGGGCGGC
GACCAGTGGGTTCAGCCCCCCCGTCGCGAGTCCCGTGTCCGCCTACCCGGCTTCATGACCGACAACGACGGGGCT
CGGCAACATGATGCCTCTGCTTCGAGGACCGTCGTCGTTGGCGGCACTCAGGCCACGCGCTTCCCTGCCAACCTC
GTGTCCAACGCCAAATACACCGCCCTGACATTTCTCCCCGTCACTCTATACAATGAATTCTCCTTCTTCTTCAAC
ATGTACTTCCTACTCGTCGCCCTTTCCCAGGCCATCCCGGCCCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCATTGGCCTTTGTTCTGCTCATTACCATGGGTAAAGAGGCCTACGACGATATAGCACGGCGCAGGAGAGACACA
GAGGCCAACTCCGAGCCCTACAGGGTTCTCACGTTTGATGATGCCGAATCGAACGCCGCCTCGCTCCGTCAGCGC
CGGCCGCTCAAGTCCGACACCGTGAGACGTGGTTCACGGAGGGCGAGAAGGCACGATCTCTCCGCCATTCAGGAA
GAGGACGACGATGTCGACGCCGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAGGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGAGAGTCCCGGCCGACGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCACTTCCAGGGAGCCCGCGGCGGAGGAAGCTTTGCTGGCCTCTGCCGAGGACGGATCTGCCTCTAAGGGT
AAGCAGCCTGCGCTCATGCACGAACTCGAGGCTGGCAACGTCGGGGAGACGTTTATCAGGACCGACCAGCTCGAT
GGCGAGACGGACTGGAAACTGAGGCTGGCCACACCCTTGACGCAAAACCTTCCCGTCGAAGAGTTTGTCCGCCTT
CGGGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCGTCGGCACGCTGGAGCTGCTTCCACCGCAGCGA
CAAGTGTCGTCGAGCCAGGAGGCGGAACAGAGCGACGAGGCCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCACAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCGGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGCTCCAAGACGGGCCTCCTCGAGTACGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCTTGACGCTTGCCCTGTCCATCGTTCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAACGCC
TGGTACATCAAGATGATGCGTTTTCTCGTTCTCTTCTCCACCATTGTGCCCATTAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCATACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTGGTCCGGACGAGCACC
ATCCCGGAGGATCTCGGACGGATCGAATATCTACTCAGCGATAAGACGGGCACGCTGACACAAAACGATATGGAG
ATGAAGAAGATCCACGTCGGTACCGTCTCGTATGCCAATGAGGCCATGGACGAGGTGGCTGCCTACGTCAAGCAG
GGCTTCGCCGTCGACGCTTACCCGATGCTCGTCACGCCGTCGTCTTCTATCGGCAACGTCGGCACGAGCCGGACC
AGGCGAGACATTGCTTCCCGCGTACGCGACGTCGTCTTGGCCTTGGCGCTCTGCCACAACGTGACGCCGACGGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAAGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGAGACCGCAAGAGCATGACGCTGCAGTCGACGGATAGCGGTCGGATC
GTGGTTCGCGTCCGCATTCTCGACGTCTTCCCATTCACGTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTC
CAGGAAAAGGTCGACGCGCCCTCGACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCCGACACT
GTCATGAGCTCCATCGTGGCCTCTAACGACTGGCTGGACGAGGAGACGGCCAACATGGCGCGAGAAGGCCTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCGTCGCGCCACCACGAGGCATCA
CTCTCCCTGTCCGGACGCGACACGGGCATGCAGACCGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAACGGGACGTCAAGCCGTCGCTGGAGCTGCTGCGCAACGCCGGCATC
AAGATCTGGATGCTGACGGGCGACAAGGTCGAGACGGCCAGGTGTGTGGCCGTCAGCTCCAAGCTCGTGGCTCGG
GGCCAGTACATCCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGTGACCAGCTCGACGTCCTCCGCAGC
AAGATGGATGCCTGTCTGCTCATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCACTTTCGACTCGACTTCATC
TCCATGGCCGTTCAGCTGCCGACGGTGGTGGCCTGTCGTTGCTCGCCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGAGTACACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGAATCGTCGGCAAGGAGGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTGGTCAAGTTGCTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCACAGTTCGTC
ATCCATCGAGGCCTCATCATCGCCGTTTGCCAGACAATGTATAGCATCGCTCTGGGGTTTGAGCCCGAGGGGCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCTACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTCGACAGG
GACGTGGACGAGGATGTGGCCAATCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGTTGTCGTAT
CGCACCTTTTTCGTCTGGGTGTTGGTGTCAGTCTACCAAGGGGGCATGATCCAGGGCTTGTCGCAGCTGCTCACC
CAGGTCAACGGCCCCAAGATGGTGGCTGTCAGTTACACGGTTCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATCAGCATCCTCGGCACCTTTGTCGCTTTCGTCGGCTCCATTCCT
TTCTTGGGGGGTTATTTCGACCTCAAGTTTATCGTTACATTGGGCTTCTTCTGGCGCATCTTTGCCATCGGCGCC
ATCTCGCTCGTCCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCGTCTTACAGAAAGGTCCAG
AGCAGGTAG
Transcript >Ophun1|4316
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGCGCCCGATTCGCCAACGCACGACTCCGACTCGGATCTTGAC
CTCGATCCGGACCTTGATCTCGGCCTTGACGACCTCGATCCCGTCTCGCCGACCCGCCATCGTCCGCCCGAGCAG
TCGGCGCCGCGGATCGCGCTGAGGAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGATACCGACAGCGGCAATGACGATGCGCCCCTGCTGGGCGGC
GACCAGTGGGTTCAGCCCCCCCGTCGCGAGTCCCGTGTCCGCCTACCCGGCTTCATGACCGACAACGACGGGGCT
CGGCAACATGATGCCTCTGCTTCGAGGACCGTCGTCGTTGGCGGCACTCAGGCCACGCGCTTCCCTGCCAACCTC
GTGTCCAACGCCAAATACACCGCCCTGACATTTCTCCCCGTCACTCTATACAATGAATTCTCCTTCTTCTTCAAC
ATGTACTTCCTACTCGTCGCCCTTTCCCAGGCCATCCCGGCCCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCATTGGCCTTTGTTCTGCTCATTACCATGGGTAAAGAGGCCTACGACGATATAGCACGGCGCAGGAGAGACACA
GAGGCCAACTCCGAGCCCTACAGGGTTCTCACGTTTGATGATGCCGAATCGAACGCCGCCTCGCTCCGTCAGCGC
CGGCCGCTCAAGTCCGACACCGTGAGACGTGGTTCACGGAGGGCGAGAAGGCACGATCTCTCCGCCATTCAGGAA
GAGGACGACGATGTCGACGCCGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAGGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGAGAGTCCCGGCCGACGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCACTTCCAGGGAGCCCGCGGCGGAGGAAGCTTTGCTGGCCTCTGCCGAGGACGGATCTGCCTCTAAGGGT
AAGCAGCCTGCGCTCATGCACGAACTCGAGGCTGGCAACGTCGGGGAGACGTTTATCAGGACCGACCAGCTCGAT
GGCGAGACGGACTGGAAACTGAGGCTGGCCACACCCTTGACGCAAAACCTTCCCGTCGAAGAGTTTGTCCGCCTT
CGGGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCGTCGGCACGCTGGAGCTGCTTCCACCGCAGCGA
CAAGTGTCGTCGAGCCAGGAGGCGGAACAGAGCGACGAGGCCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCACAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCGGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGCTCCAAGACGGGCCTCCTCGAGTACGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCTTGACGCTTGCCCTGTCCATCGTTCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAACGCC
TGGTACATCAAGATGATGCGTTTTCTCGTTCTCTTCTCCACCATTGTGCCCATTAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCATACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTGGTCCGGACGAGCACC
ATCCCGGAGGATCTCGGACGGATCGAATATCTACTCAGCGATAAGACGGGCACGCTGACACAAAACGATATGGAG
ATGAAGAAGATCCACGTCGGTACCGTCTCGTATGCCAATGAGGCCATGGACGAGGTGGCTGCCTACGTCAAGCAG
GGCTTCGCCGTCGACGCTTACCCGATGCTCGTCACGCCGTCGTCTTCTATCGGCAACGTCGGCACGAGCCGGACC
AGGCGAGACATTGCTTCCCGCGTACGCGACGTCGTCTTGGCCTTGGCGCTCTGCCACAACGTGACGCCGACGGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAAGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGAGACCGCAAGAGCATGACGCTGCAGTCGACGGATAGCGGTCGGATC
GTGGTTCGCGTCCGCATTCTCGACGTCTTCCCATTCACGTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTC
CAGGAAAAGGTCGACGCGCCCTCGACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCCGACACT
GTCATGAGCTCCATCGTGGCCTCTAACGACTGGCTGGACGAGGAGACGGCCAACATGGCGCGAGAAGGCCTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCGTCGCGCCACCACGAGGCATCA
CTCTCCCTGTCCGGACGCGACACGGGCATGCAGACCGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAACGGGACGTCAAGCCGTCGCTGGAGCTGCTGCGCAACGCCGGCATC
AAGATCTGGATGCTGACGGGCGACAAGGTCGAGACGGCCAGGTGTGTGGCCGTCAGCTCCAAGCTCGTGGCTCGG
GGCCAGTACATCCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGTGACCAGCTCGACGTCCTCCGCAGC
AAGATGGATGCCTGTCTGCTCATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCACTTTCGACTCGACTTCATC
TCCATGGCCGTTCAGCTGCCGACGGTGGTGGCCTGTCGTTGCTCGCCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGAGTACACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGAATCGTCGGCAAGGAGGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTGGTCAAGTTGCTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCACAGTTCGTC
ATCCATCGAGGCCTCATCATCGCCGTTTGCCAGACAATGTATAGCATCGCTCTGGGGTTTGAGCCCGAGGGGCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCTACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTCGACAGG
GACGTGGACGAGGATGTGGCCAATCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGTTGTCGTAT
CGCACCTTTTTCGTCTGGGTGTTGGTGTCAGTCTACCAAGGGGGCATGATCCAGGGCTTGTCGCAGCTGCTCACC
CAGGTCAACGGCCCCAAGATGGTGGCTGTCAGTTACACGGTTCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATCAGCATCCTCGGCACCTTTGTCGCTTTCGTCGGCTCCATTCCT
TTCTTGGGGGGTTATTTCGACCTCAAGTTTATCGTTACATTGGGCTTCTTCTGGCGCATCTTTGCCATCGGCGCC
ATCTCGCTCGTCCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCGTCTTACAGAAAGGTCCAG
AGCAGGTAG
Gene >Ophun1|4316
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGCGCCCGATTCGCCAACGCACGACTCCGACTCGGATCTTGAC
CTCGATCCGGACCTTGATCTCGGCCTTGACGACCTCGATCCCGTCTCGCCGACCCGCCATCGTCCGCCCGAGCAG
TCGGCGCCGCGGATCGCGCTGAGGAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGATACCGACAGCGGCAATGACGATGCGCCCCTGCTGGGCGGC
GACCAGTGGGTTCAGCCCCCCCGTCGCGAGTCCCGTGTCCGCCTACCCGGCTTCATGACCGACAACGACGGGGCT
CGGCAACATGATGCCTCTGCTTCGAGGACCGTCGTCGTTGGCGGCACTCAGGCCACGCGCTTCCCTGCCAACCTC
GTGTCCAACGCCAAATACACCGCCCTGACATTTCTCCCCGTCACTCTATACAATGAATTCTCCTTCTTCTTCAAC
ATGTACTTCCTACTCGTCGCCCTTTCCCAGGCCATCCCGGCCCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCATTGGCCTTTGTTCTGCTCATTACCATGGGTAAAGAGGCCTACGACGATATAGCACGGCGCAGGAGAGACACA
GAGGCCAACTCCGAGCCCTACAGGGTTCTCACGTTTGATGATGCCGAATCGAACGCCGCCTCGCTCCGTCAGCGC
CGGCCGCTCAAGTCCGACACCGTGAGACGTGGTTCACGGAGGGCGAGAAGGCACGATCTCTCCGCCATTCAGGAA
GAGGACGACGATGTCGACGCCGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAGGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGAGAGTCCCGGCCGACGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCACTTCCAGGGAGCCCGCGGCGGAGGAAGCTTTGCTGGCCTCTGCCGAGGACGGATCTGCCTCTAAGGGT
AAGCAGCCTGCGCTCATGCACGAACTCGAGGCTGGCAACGTCGGGGAGACGTTTATCAGGACCGACCAGCTCGAT
GGCGAGACGGACTGGAAACTGAGGCTGGCCACACCCTTGACGCAAAACCTTCCCGTCGAAGAGTTTGTCCGCCTT
CGGGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCGTCGGCACGCTGGAGCTGCTTCCACCGCAGCGA
CAAGTGTCGTCGAGCCAGGAGGCGGAACAGAGCGACGAGGCCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCACAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCGGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGCTCCAAGACGGGCCTCCTCGAGTACGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCTTGACGCTTGCCCTGTCCATCGTTCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAACGCC
TGGTACATCAAGATGATGCGTTTTCTCGTTCTCTTCTCCACCATTGTGCCCATTAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCATACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTGGTCCGGACGAGCACC
ATCCCGGAGGATCTCGGACGGATCGAATATCTACTCAGCGATAAGACGGGCACGCTGACACAAAACGATATGGAG
ATGAAGAAGATCCACGTCGGTACCGTCTCGTATGCCAATGAGGCCATGGACGAGGTGGCTGCCTACGTCAAGCAG
GGCTTCGCCGTCGACGCTTACCCGATGCTCGTCACGCCGTCGTCTTCTATCGGCAACGTCGGCACGAGCCGGACC
AGGCGAGACATTGCTTCCCGCGTACGCGACGTCGTCTTGGCCTTGGCGCTCTGCCACAACGTGACGCCGACGGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAAGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGAGACCGCAAGAGCATGACGCTGCAGTCGACGGATAGCGGTCGGATC
GTGGTTCGCGTCCGCATTCTCGACGTCTTCCCATTCACGTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTC
CAGGAAAAGGTCGACGCGCCCTCGACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCCGACACT
GTCATGAGCTCCATCGTGGCCTCTAACGACTGGCTGGACGAGGAGACGGCCAACATGGCGCGAGAAGGCCTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCGTCGCGCCACCACGAGGCATCA
CTCTCCCTGTCCGGACGCGACACGGGCATGCAGACCGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAACGGGACGTCAAGCCGTCGCTGGAGCTGCTGCGCAACGCCGGCATC
AAGATCTGGATGCTGACGGGCGACAAGGTCGAGACGGCCAGGTGTGTGGCCGTCAGCTCCAAGCTCGTGGCTCGG
GGCCAGTACATCCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGTGACCAGCTCGACGTCCTCCGCAGC
AAGATGGATGCCTGTCTGCTCATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCACTTTCGACTCGACTTCATC
TCCATGGCCGTTCAGCTGCCGACGGTGGTGGCCTGTCGTTGCTCGCCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGAGTACACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGAATCGTCGGCAAGGAGGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTGGTCAAGTTGCTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCACAGTTCGTC
ATCCATCGAGGCCTCATCATCGCCGTTTGCCAGACAATGTATAGCATCGCTCTGGGGTTTGAGCCCGAGGGGCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCTACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTCGACAGG
GACGTGGACGAGGATGTGGCCAATCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGTTGTCGTAT
CGCACCTTTTTCGTCTGGGTGTTGGTGTCAGTCTACCAAGGGGGCATGATCCAGGGCTTGTCGCAGCTGCTCACC
CAGGTCAACGGCCCCAAGATGGTGGCTGTCAGTTACACGGTTCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATCAGCATCCTCGGCACCTTTGTCGCTTTCGTCGGCTCCATTCCT
TTCTTGGGGGGTTATTTCGACCTCAAGTTTATCGTTACATTGTTCGTCTCTTGTTTTCCTCCTTTTCTCTGAATC
GGCCAGGGCCATTGACTGACCTTGATACCCTTTCTCTCCTGTAGGGGCTTCTTCTGGCGCATCTTTGCCATCGGC
GCCATCTCGCTCGTCCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCGTCTTACAGAAAGGTC
CAGAGCAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail