Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4316
Gene name
LocationContig_4:13655..17492
Strand-
Gene length (bp)3837
Transcript length (bp)3759
Coding sequence length (bp)3759
Protein length (aa) 1253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 2.1E-51 1016 1243
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 2.7E-15 143 193
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.4E-06 585 892
PF13246 Cation_ATPase Cation transport ATPase (P-type) 5.5E-05 667 777

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 131 1250 0.0E+00
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 144 1250 0.0E+00
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 134 1251 0.0E+00
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 134 1251 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 133 1251 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 131 1250 0.0E+00
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 144 1250 0.0E+00
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 134 1251 0.0E+00
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 134 1251 0.0E+00
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 133 1251 0.0E+00
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 133 1251 0.0E+00
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 125 1251 0.0E+00
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 125 1251 0.0E+00
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 133 1251 0.0E+00
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 149 1250 5.0E-120
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 110 1239 1.0E-116
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 110 1239 8.0E-116
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 110 1239 1.0E-113
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 142 1204 1.0E-111
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 133 1129 1.0E-111
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 123 1250 1.0E-111
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 133 1129 2.0E-111
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 133 1129 5.0E-111
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 57 1250 4.0E-109
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 146 1247 1.0E-108
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 145 1250 8.0E-108
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 146 1250 4.0E-105
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 140 1250 6.0E-105
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 142 1133 4.0E-104
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 83 1197 2.0E-103
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 145 1250 2.0E-102
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 145 1250 1.0E-101
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 145 1243 2.0E-101
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 145 1243 8.0E-101
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 131 1250 8.0E-101
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 146 1236 1.0E-100
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 124 1243 4.0E-100
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 146 1142 6.0E-100
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 146 1232 2.0E-99
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 145 1208 4.0E-99
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 133 1252 7.0E-99
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 140 1179 1.0E-98
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 146 1246 2.0E-98
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 142 1197 3.0E-97
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 131 1250 8.0E-97
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 146 1146 1.0E-96
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 142 1197 9.0E-96
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 133 1251 6.0E-95
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 132 1204 6.0E-94
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 115 1204 2.0E-93
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 145 1167 4.0E-92
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 146 1228 2.0E-88
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 146 1138 4.0E-85
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 137 1189 4.0E-80
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 685 1138 1.0E-68
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 686 1193 3.0E-65
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 686 1138 2.0E-61
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 686 1195 3.0E-61
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 686 1180 7.0E-60
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 686 1132 1.0E-59
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 794 1217 7.0E-53
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 789 1243 9.0E-48
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 149 611 1.0E-34
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 296 777 2.0E-30
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 145 614 1.0E-24
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 149 615 2.0E-24
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 143 615 1.0E-23
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 82 614 9.0E-21
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 145 614 4.0E-19
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 569 1072 2.0E-18
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 541 1173 6.0E-16
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 570 1049 6.0E-16
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 569 1194 2.0E-15
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 569 1237 1.0E-14
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 569 1234 1.0E-14
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 520 1138 2.0E-14
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 534 1056 8.0E-14
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 530 1240 1.0E-13
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 490 1052 2.0E-13
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 490 1049 4.0E-13
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 729 1030 1.0E-12
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 473 1049 6.0E-12
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 727 1021 4.0E-11
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 845 1049 4.0E-11
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 845 1049 5.0E-11
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 490 1066 1.0E-10
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 490 1066 2.0E-10
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 490 1066 2.0E-10
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 731 1030 3.0E-10
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 569 1140 3.0E-10
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 569 1139 3.0E-10
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 569 1072 4.0E-10
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 794 1049 1.0E-09
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 541 1139 2.0E-08
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 736 1021 6.0E-08
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 771 1020 7.0E-08
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 465 1008 8.0E-08
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 771 1020 8.0E-08
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 726 1021 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 160 182 22
2 189 211 22
3 1079 1098 19
4 1123 1142 19
5 1157 1176 19
6 1183 1205 22
7 1215 1237 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4316
MGGMPPSPPFRAPDSPTHDSDSDLDLDPDLDLGLDDLDPVSPTRHRPPEQSAPRIALRNLRMGSLRRAQKRGRAY
GQLGTPRDDTADTDSGNDDAPLLGGDQWVQPPRRESRVRLPGFMTDNDGARQHDASASRTVVVGGTQATRFPANL
VSNAKYTALTFLPVTLYNEFSFFFNMYFLLVALSQAIPALRIGYLSTYVAPLAFVLLITMGKEAYDDIARRRRDT
EANSEPYRVLTFDDAESNAASLRQRRPLKSDTVRRGSRRARRHDLSAIQEEDDDVDAVPSSHVQEVSRKSKDLKV
GQVLKLSKGQRVPADVVILQCCASDGCTSREPAAEEALLASAEDGSASKGKQPALMHELEAGNVGETFIRTDQLD
GETDWKLRLATPLTQNLPVEEFVRLRVTGGKPDKSVNEFVGTLELLPPQRQVSSSQEAEQSDEAAKSWALSIDNT
AWANTVIASQGTTLAVILYTGPETRSALSTAPSRSKTGLLEYEINSLTKILCALTLALSIVLVALQGFEKTGGNA
WYIKMMRFLVLFSTIVPISLRVNLDLGKSAYSRFIQHDPGIPGAVVRTSTIPEDLGRIEYLLSDKTGTLTQNDME
MKKIHVGTVSYANEAMDEVAAYVKQGFAVDAYPMLVTPSSSIGNVGTSRTRRDIASRVRDVVLALALCHNVTPTV
DSEDGRQVTSYQASSPDEIAIVKWAESVGLRLASRDRKSMTLQSTDSGRIVVRVRILDVFPFTSDGKRMGIIVHF
QEKVDAPSTDLGSGDIWFYQKGADTVMSSIVASNDWLDEETANMAREGLRTLVVGRKKLSAQQYSEFSSRHHEAS
LSLSGRDTGMQTVVSRYLETDLELLGVTGVEDKLQRDVKPSLELLRNAGIKIWMLTGDKVETARCVAVSSKLVAR
GQYIQTMARLKKKDYARDQLDVLRSKMDACLLIDGESLALLLTHFRLDFISMAVQLPTVVACRCSPTQKAEVAKL
IKEYTKKRVCCIGDGGNDVSMIQAADVGVGIVGKEGRQASLAADFSIEQFCHLVKLLVWHGRNSYKRSAKLAQFV
IHRGLIIAVCQTMYSIALGFEPEGLYKDWLLVGYATVYTAAPVLSLVLDRDVDEDVANLYPELYKELTSGRSLSY
RTFFVWVLVSVYQGGMIQGLSQLLTQVNGPKMVAVSYTVLVLNELIMVAIEITTWHPVMIISILGTFVAFVGSIP
FLGGYFDLKFIVTLGFFWRIFAIGAISLVPPYAGKLIRRAIKPPSYRKVQSR*
Coding >Ophun1|4316
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGCGCCCGATTCGCCAACGCACGACTCCGACTCGGATCTTGAC
CTCGATCCGGACCTTGATCTCGGCCTTGACGACCTCGATCCCGTCTCGCCGACCCGCCATCGTCCGCCCGAGCAG
TCGGCGCCGCGGATCGCGCTGAGGAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGATACCGACAGCGGCAATGACGATGCGCCCCTGCTGGGCGGC
GACCAGTGGGTTCAGCCCCCCCGTCGCGAGTCCCGTGTCCGCCTACCCGGCTTCATGACCGACAACGACGGGGCT
CGGCAACATGATGCCTCTGCTTCGAGGACCGTCGTCGTTGGCGGCACTCAGGCCACGCGCTTCCCTGCCAACCTC
GTGTCCAACGCCAAATACACCGCCCTGACATTTCTCCCCGTCACTCTATACAATGAATTCTCCTTCTTCTTCAAC
ATGTACTTCCTACTCGTCGCCCTTTCCCAGGCCATCCCGGCCCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCATTGGCCTTTGTTCTGCTCATTACCATGGGTAAAGAGGCCTACGACGATATAGCACGGCGCAGGAGAGACACA
GAGGCCAACTCCGAGCCCTACAGGGTTCTCACGTTTGATGATGCCGAATCGAACGCCGCCTCGCTCCGTCAGCGC
CGGCCGCTCAAGTCCGACACCGTGAGACGTGGTTCACGGAGGGCGAGAAGGCACGATCTCTCCGCCATTCAGGAA
GAGGACGACGATGTCGACGCCGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAGGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGAGAGTCCCGGCCGACGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCACTTCCAGGGAGCCCGCGGCGGAGGAAGCTTTGCTGGCCTCTGCCGAGGACGGATCTGCCTCTAAGGGT
AAGCAGCCTGCGCTCATGCACGAACTCGAGGCTGGCAACGTCGGGGAGACGTTTATCAGGACCGACCAGCTCGAT
GGCGAGACGGACTGGAAACTGAGGCTGGCCACACCCTTGACGCAAAACCTTCCCGTCGAAGAGTTTGTCCGCCTT
CGGGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCGTCGGCACGCTGGAGCTGCTTCCACCGCAGCGA
CAAGTGTCGTCGAGCCAGGAGGCGGAACAGAGCGACGAGGCCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCACAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCGGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGCTCCAAGACGGGCCTCCTCGAGTACGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCTTGACGCTTGCCCTGTCCATCGTTCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAACGCC
TGGTACATCAAGATGATGCGTTTTCTCGTTCTCTTCTCCACCATTGTGCCCATTAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCATACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTGGTCCGGACGAGCACC
ATCCCGGAGGATCTCGGACGGATCGAATATCTACTCAGCGATAAGACGGGCACGCTGACACAAAACGATATGGAG
ATGAAGAAGATCCACGTCGGTACCGTCTCGTATGCCAATGAGGCCATGGACGAGGTGGCTGCCTACGTCAAGCAG
GGCTTCGCCGTCGACGCTTACCCGATGCTCGTCACGCCGTCGTCTTCTATCGGCAACGTCGGCACGAGCCGGACC
AGGCGAGACATTGCTTCCCGCGTACGCGACGTCGTCTTGGCCTTGGCGCTCTGCCACAACGTGACGCCGACGGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAAGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGAGACCGCAAGAGCATGACGCTGCAGTCGACGGATAGCGGTCGGATC
GTGGTTCGCGTCCGCATTCTCGACGTCTTCCCATTCACGTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTC
CAGGAAAAGGTCGACGCGCCCTCGACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCCGACACT
GTCATGAGCTCCATCGTGGCCTCTAACGACTGGCTGGACGAGGAGACGGCCAACATGGCGCGAGAAGGCCTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCGTCGCGCCACCACGAGGCATCA
CTCTCCCTGTCCGGACGCGACACGGGCATGCAGACCGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAACGGGACGTCAAGCCGTCGCTGGAGCTGCTGCGCAACGCCGGCATC
AAGATCTGGATGCTGACGGGCGACAAGGTCGAGACGGCCAGGTGTGTGGCCGTCAGCTCCAAGCTCGTGGCTCGG
GGCCAGTACATCCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGTGACCAGCTCGACGTCCTCCGCAGC
AAGATGGATGCCTGTCTGCTCATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCACTTTCGACTCGACTTCATC
TCCATGGCCGTTCAGCTGCCGACGGTGGTGGCCTGTCGTTGCTCGCCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGAGTACACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGAATCGTCGGCAAGGAGGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTGGTCAAGTTGCTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCACAGTTCGTC
ATCCATCGAGGCCTCATCATCGCCGTTTGCCAGACAATGTATAGCATCGCTCTGGGGTTTGAGCCCGAGGGGCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCTACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTCGACAGG
GACGTGGACGAGGATGTGGCCAATCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGTTGTCGTAT
CGCACCTTTTTCGTCTGGGTGTTGGTGTCAGTCTACCAAGGGGGCATGATCCAGGGCTTGTCGCAGCTGCTCACC
CAGGTCAACGGCCCCAAGATGGTGGCTGTCAGTTACACGGTTCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATCAGCATCCTCGGCACCTTTGTCGCTTTCGTCGGCTCCATTCCT
TTCTTGGGGGGTTATTTCGACCTCAAGTTTATCGTTACATTGGGCTTCTTCTGGCGCATCTTTGCCATCGGCGCC
ATCTCGCTCGTCCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCGTCTTACAGAAAGGTCCAG
AGCAGGTAG
Transcript >Ophun1|4316
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGCGCCCGATTCGCCAACGCACGACTCCGACTCGGATCTTGAC
CTCGATCCGGACCTTGATCTCGGCCTTGACGACCTCGATCCCGTCTCGCCGACCCGCCATCGTCCGCCCGAGCAG
TCGGCGCCGCGGATCGCGCTGAGGAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGATACCGACAGCGGCAATGACGATGCGCCCCTGCTGGGCGGC
GACCAGTGGGTTCAGCCCCCCCGTCGCGAGTCCCGTGTCCGCCTACCCGGCTTCATGACCGACAACGACGGGGCT
CGGCAACATGATGCCTCTGCTTCGAGGACCGTCGTCGTTGGCGGCACTCAGGCCACGCGCTTCCCTGCCAACCTC
GTGTCCAACGCCAAATACACCGCCCTGACATTTCTCCCCGTCACTCTATACAATGAATTCTCCTTCTTCTTCAAC
ATGTACTTCCTACTCGTCGCCCTTTCCCAGGCCATCCCGGCCCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCATTGGCCTTTGTTCTGCTCATTACCATGGGTAAAGAGGCCTACGACGATATAGCACGGCGCAGGAGAGACACA
GAGGCCAACTCCGAGCCCTACAGGGTTCTCACGTTTGATGATGCCGAATCGAACGCCGCCTCGCTCCGTCAGCGC
CGGCCGCTCAAGTCCGACACCGTGAGACGTGGTTCACGGAGGGCGAGAAGGCACGATCTCTCCGCCATTCAGGAA
GAGGACGACGATGTCGACGCCGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAGGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGAGAGTCCCGGCCGACGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCACTTCCAGGGAGCCCGCGGCGGAGGAAGCTTTGCTGGCCTCTGCCGAGGACGGATCTGCCTCTAAGGGT
AAGCAGCCTGCGCTCATGCACGAACTCGAGGCTGGCAACGTCGGGGAGACGTTTATCAGGACCGACCAGCTCGAT
GGCGAGACGGACTGGAAACTGAGGCTGGCCACACCCTTGACGCAAAACCTTCCCGTCGAAGAGTTTGTCCGCCTT
CGGGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCGTCGGCACGCTGGAGCTGCTTCCACCGCAGCGA
CAAGTGTCGTCGAGCCAGGAGGCGGAACAGAGCGACGAGGCCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCACAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCGGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGCTCCAAGACGGGCCTCCTCGAGTACGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCTTGACGCTTGCCCTGTCCATCGTTCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAACGCC
TGGTACATCAAGATGATGCGTTTTCTCGTTCTCTTCTCCACCATTGTGCCCATTAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCATACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTGGTCCGGACGAGCACC
ATCCCGGAGGATCTCGGACGGATCGAATATCTACTCAGCGATAAGACGGGCACGCTGACACAAAACGATATGGAG
ATGAAGAAGATCCACGTCGGTACCGTCTCGTATGCCAATGAGGCCATGGACGAGGTGGCTGCCTACGTCAAGCAG
GGCTTCGCCGTCGACGCTTACCCGATGCTCGTCACGCCGTCGTCTTCTATCGGCAACGTCGGCACGAGCCGGACC
AGGCGAGACATTGCTTCCCGCGTACGCGACGTCGTCTTGGCCTTGGCGCTCTGCCACAACGTGACGCCGACGGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAAGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGAGACCGCAAGAGCATGACGCTGCAGTCGACGGATAGCGGTCGGATC
GTGGTTCGCGTCCGCATTCTCGACGTCTTCCCATTCACGTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTC
CAGGAAAAGGTCGACGCGCCCTCGACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCCGACACT
GTCATGAGCTCCATCGTGGCCTCTAACGACTGGCTGGACGAGGAGACGGCCAACATGGCGCGAGAAGGCCTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCGTCGCGCCACCACGAGGCATCA
CTCTCCCTGTCCGGACGCGACACGGGCATGCAGACCGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAACGGGACGTCAAGCCGTCGCTGGAGCTGCTGCGCAACGCCGGCATC
AAGATCTGGATGCTGACGGGCGACAAGGTCGAGACGGCCAGGTGTGTGGCCGTCAGCTCCAAGCTCGTGGCTCGG
GGCCAGTACATCCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGTGACCAGCTCGACGTCCTCCGCAGC
AAGATGGATGCCTGTCTGCTCATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCACTTTCGACTCGACTTCATC
TCCATGGCCGTTCAGCTGCCGACGGTGGTGGCCTGTCGTTGCTCGCCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGAGTACACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGAATCGTCGGCAAGGAGGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTGGTCAAGTTGCTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCACAGTTCGTC
ATCCATCGAGGCCTCATCATCGCCGTTTGCCAGACAATGTATAGCATCGCTCTGGGGTTTGAGCCCGAGGGGCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCTACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTCGACAGG
GACGTGGACGAGGATGTGGCCAATCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGTTGTCGTAT
CGCACCTTTTTCGTCTGGGTGTTGGTGTCAGTCTACCAAGGGGGCATGATCCAGGGCTTGTCGCAGCTGCTCACC
CAGGTCAACGGCCCCAAGATGGTGGCTGTCAGTTACACGGTTCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATCAGCATCCTCGGCACCTTTGTCGCTTTCGTCGGCTCCATTCCT
TTCTTGGGGGGTTATTTCGACCTCAAGTTTATCGTTACATTGGGCTTCTTCTGGCGCATCTTTGCCATCGGCGCC
ATCTCGCTCGTCCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCGTCTTACAGAAAGGTCCAG
AGCAGGTAG
Gene >Ophun1|4316
ATGGGCGGGATGCCTCCTTCACCCCCTTTCCGAGCGCCCGATTCGCCAACGCACGACTCCGACTCGGATCTTGAC
CTCGATCCGGACCTTGATCTCGGCCTTGACGACCTCGATCCCGTCTCGCCGACCCGCCATCGTCCGCCCGAGCAG
TCGGCGCCGCGGATCGCGCTGAGGAACCTGCGCATGGGAAGCCTGCGTCGCGCCCAGAAGCGAGGCCGTGCCTAT
GGCCAACTTGGCACCCCCCGCGACGACACGGCCGATACCGACAGCGGCAATGACGATGCGCCCCTGCTGGGCGGC
GACCAGTGGGTTCAGCCCCCCCGTCGCGAGTCCCGTGTCCGCCTACCCGGCTTCATGACCGACAACGACGGGGCT
CGGCAACATGATGCCTCTGCTTCGAGGACCGTCGTCGTTGGCGGCACTCAGGCCACGCGCTTCCCTGCCAACCTC
GTGTCCAACGCCAAATACACCGCCCTGACATTTCTCCCCGTCACTCTATACAATGAATTCTCCTTCTTCTTCAAC
ATGTACTTCCTACTCGTCGCCCTTTCCCAGGCCATCCCGGCCCTGCGCATCGGCTACCTCTCCACCTACGTCGCC
CCATTGGCCTTTGTTCTGCTCATTACCATGGGTAAAGAGGCCTACGACGATATAGCACGGCGCAGGAGAGACACA
GAGGCCAACTCCGAGCCCTACAGGGTTCTCACGTTTGATGATGCCGAATCGAACGCCGCCTCGCTCCGTCAGCGC
CGGCCGCTCAAGTCCGACACCGTGAGACGTGGTTCACGGAGGGCGAGAAGGCACGATCTCTCCGCCATTCAGGAA
GAGGACGACGATGTCGACGCCGTACCCTCTTCGCACGTCCAGGAAGTCAGCCGCAAATCCAAGGATCTCAAGGTC
GGCCAGGTTCTGAAACTCAGCAAGGGGCAGAGAGTCCCGGCCGACGTAGTCATCCTGCAGTGCTGTGCTTCCGAC
GGCTGCACTTCCAGGGAGCCCGCGGCGGAGGAAGCTTTGCTGGCCTCTGCCGAGGACGGATCTGCCTCTAAGGGT
AAGCAGCCTGCGCTCATGCACGAACTCGAGGCTGGCAACGTCGGGGAGACGTTTATCAGGACCGACCAGCTCGAT
GGCGAGACGGACTGGAAACTGAGGCTGGCCACACCCTTGACGCAAAACCTTCCCGTCGAAGAGTTTGTCCGCCTT
CGGGTGACGGGCGGGAAGCCGGACAAGTCGGTCAACGAATTCGTCGGCACGCTGGAGCTGCTTCCACCGCAGCGA
CAAGTGTCGTCGAGCCAGGAGGCGGAACAGAGCGACGAGGCCGCCAAGTCGTGGGCGCTGTCCATCGACAACACG
GCTTGGGCCAATACGGTCATCGCCTCACAGGGCACGACGCTGGCCGTCATCCTGTATACGGGCCCGGAGACGCGG
TCTGCGCTGTCGACGGCGCCTTCGCGCTCCAAGACGGGCCTCCTCGAGTACGAGATCAACTCGTTGACCAAGATC
TTGTGCGCCTTGACGCTTGCCCTGTCCATCGTTCTCGTCGCCCTCCAGGGCTTTGAGAAGACGGGGGGCAACGCC
TGGTACATCAAGATGATGCGTTTTCTCGTTCTCTTCTCCACCATTGTGCCCATTAGCCTGCGCGTGAACCTGGAC
CTGGGCAAGAGCGCATACTCGAGGTTCATCCAGCACGACCCGGGCATCCCGGGCGCCGTGGTCCGGACGAGCACC
ATCCCGGAGGATCTCGGACGGATCGAATATCTACTCAGCGATAAGACGGGCACGCTGACACAAAACGATATGGAG
ATGAAGAAGATCCACGTCGGTACCGTCTCGTATGCCAATGAGGCCATGGACGAGGTGGCTGCCTACGTCAAGCAG
GGCTTCGCCGTCGACGCTTACCCGATGCTCGTCACGCCGTCGTCTTCTATCGGCAACGTCGGCACGAGCCGGACC
AGGCGAGACATTGCTTCCCGCGTACGCGACGTCGTCTTGGCCTTGGCGCTCTGCCACAACGTGACGCCGACGGTC
GACAGCGAGGACGGCAGGCAGGTGACGTCGTATCAAGCCTCGTCGCCGGACGAGATCGCCATCGTCAAGTGGGCC
GAGTCGGTCGGGCTCAGGCTGGCGTCGCGAGACCGCAAGAGCATGACGCTGCAGTCGACGGATAGCGGTCGGATC
GTGGTTCGCGTCCGCATTCTCGACGTCTTCCCATTCACGTCGGACGGCAAGCGGATGGGCATCATCGTCCACTTC
CAGGAAAAGGTCGACGCGCCCTCGACGGACCTCGGCAGCGGCGACATCTGGTTCTACCAAAAGGGGGCCGACACT
GTCATGAGCTCCATCGTGGCCTCTAACGACTGGCTGGACGAGGAGACGGCCAACATGGCGCGAGAAGGCCTACGG
ACGCTCGTCGTCGGCCGCAAGAAGCTCTCGGCCCAGCAGTATAGCGAGTTCTCGTCGCGCCACCACGAGGCATCA
CTCTCCCTGTCCGGACGCGACACGGGCATGCAGACCGTCGTCTCGCGCTACCTCGAGACGGACCTCGAGCTGCTG
GGCGTGACGGGCGTCGAGGACAAGCTGCAACGGGACGTCAAGCCGTCGCTGGAGCTGCTGCGCAACGCCGGCATC
AAGATCTGGATGCTGACGGGCGACAAGGTCGAGACGGCCAGGTGTGTGGCCGTCAGCTCCAAGCTCGTGGCTCGG
GGCCAGTACATCCAGACGATGGCCCGGCTCAAGAAGAAGGACTACGCCCGTGACCAGCTCGACGTCCTCCGCAGC
AAGATGGATGCCTGTCTGCTCATCGACGGCGAGAGCCTGGCGCTTCTGCTGACGCACTTTCGACTCGACTTCATC
TCCATGGCCGTTCAGCTGCCGACGGTGGTGGCCTGTCGTTGCTCGCCGACTCAAAAGGCCGAGGTGGCGAAGCTG
ATCAAGGAGTACACCAAGAAGCGCGTCTGCTGCATCGGCGACGGCGGCAACGACGTGTCCATGATCCAGGCCGCC
GACGTCGGCGTCGGAATCGTCGGCAAGGAGGGTCGTCAGGCCAGTCTGGCGGCCGACTTCTCCATCGAGCAGTTC
TGCCACCTGGTCAAGTTGCTCGTCTGGCACGGGCGCAACAGCTACAAGCGGAGTGCCAAGCTGGCACAGTTCGTC
ATCCATCGAGGCCTCATCATCGCCGTTTGCCAGACAATGTATAGCATCGCTCTGGGGTTTGAGCCCGAGGGGCTC
TACAAGGACTGGCTTCTTGTCGGCTACGCTACCGTCTACACGGCCGCGCCCGTCCTCTCGCTGGTCCTCGACAGG
GACGTGGACGAGGATGTGGCCAATCTCTATCCGGAGCTTTATAAAGAGCTCACATCGGGCCGCTCGTTGTCGTAT
CGCACCTTTTTCGTCTGGGTGTTGGTGTCAGTCTACCAAGGGGGCATGATCCAGGGCTTGTCGCAGCTGCTCACC
CAGGTCAACGGCCCCAAGATGGTGGCTGTCAGTTACACGGTTCTGGTGCTCAACGAGCTCATCATGGTGGCCATT
GAGATTACGACGTGGCACCCGGTCATGATCATCAGCATCCTCGGCACCTTTGTCGCTTTCGTCGGCTCCATTCCT
TTCTTGGGGGGTTATTTCGACCTCAAGTTTATCGTTACATTGTTCGTCTCTTGTTTTCCTCCTTTTCTCTGAATC
GGCCAGGGCCATTGACTGACCTTGATACCCTTTCTCTCCTGTAGGGGCTTCTTCTGGCGCATCTTTGCCATCGGC
GCCATCTCGCTCGTCCCTCCCTACGCCGGCAAGCTGATACGGAGAGCCATCAAGCCGCCGTCTTACAGAAAGGTC
CAGAGCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail