Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|431
Gene name
LocationContig_112:13856..14640
Strand-
Gene length (bp)784
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 1.3E-14 156 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BZQ6|BOS1_YARLI Protein transport protein BOS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BOS1 PE=3 SV=1 1 239 3.0E-38
sp|Q9P7G5|BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bos1 PE=3 SV=1 2 243 2.0E-35
sp|Q6BVM4|BOS1_DEBHA Protein transport protein BOS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BOS1 PE=3 SV=1 1 243 3.0E-34
sp|Q9VRL2|GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster GN=Membrin PE=2 SV=1 161 242 2.0E-13
sp|P25385|BOS1_YEAST Protein transport protein BOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOS1 PE=1 SV=1 1 243 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BZQ6|BOS1_YARLI Protein transport protein BOS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BOS1 PE=3 SV=1 1 239 3.0E-38
sp|Q9P7G5|BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bos1 PE=3 SV=1 2 243 2.0E-35
sp|Q6BVM4|BOS1_DEBHA Protein transport protein BOS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BOS1 PE=3 SV=1 1 243 3.0E-34
sp|Q9VRL2|GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster GN=Membrin PE=2 SV=1 161 242 2.0E-13
sp|P25385|BOS1_YEAST Protein transport protein BOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOS1 PE=1 SV=1 1 243 5.0E-13
sp|Q9FK28|MEM12_ARATH Membrin-12 OS=Arabidopsis thaliana GN=MEMB12 PE=2 SV=1 141 243 5.0E-13
sp|O35165|GOSR2_RAT Golgi SNAP receptor complex member 2 OS=Rattus norvegicus GN=Gosr2 PE=1 SV=2 161 242 5.0E-13
sp|O35166|GOSR2_MOUSE Golgi SNAP receptor complex member 2 OS=Mus musculus GN=Gosr2 PE=1 SV=2 161 242 8.0E-13
sp|Q75CY3|BOS1_ASHGO Protein transport protein BOS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BOS1 PE=3 SV=2 1 239 1.0E-12
sp|Q9SJL6|MEM11_ARATH Membrin-11 OS=Arabidopsis thaliana GN=MEMB11 PE=1 SV=1 161 243 2.0E-12
sp|O14653|GOSR2_HUMAN Golgi SNAP receptor complex member 2 OS=Homo sapiens GN=GOSR2 PE=1 SV=2 161 242 4.0E-12
sp|A8XP14|GOSR2_CAEBR Probable Golgi SNAP receptor complex member 2 OS=Caenorhabditis briggsae GN=gosr-2.1 PE=3 SV=1 153 243 8.0E-10
sp|P41941|GOSR2_CAEEL Probable Golgi SNAP receptor complex member 2 OS=Caenorhabditis elegans GN=gosr-2.1 PE=3 SV=1 153 243 2.0E-08
sp|Q6FKA1|BOS1_CANGA Protein transport protein BOS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BOS1 PE=3 SV=1 1 243 6.0E-08
sp|Q6CRX0|BOS1_KLULA Protein transport protein BOS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BOS1 PE=3 SV=1 1 221 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 222 241 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|431
MNVLYNSALRQSRAIRAELVELNAKGAPTPAEMGNVSASLASFGKTINDYQQLSRQELVQKKQEEAVERIKKFRL
DLSDFRSQIDALNKVREDAQHQANRSELLGRRPYNATPENPYANAAVGPTPSAFQPRQPAHAGGSLTTGSADEVR
EAHAFREQNFLANTNQALDDYIARGQAVLGDLGQQREMLKNTQKRLYTVANTLGVSGDTIRMVERRAREDKWIFF
AGVIAFFLFCWLVLHYLR*
Coding >Ophun1|431
ATGAACGTGCTATACAACTCGGCCCTGCGGCAGAGCAGGGCCATCCGCGCCGAGCTGGTCGAGCTCAATGCCAAG
GGCGCGCCGACGCCGGCCGAGATGGGCAATGTATCTGCATCTCTTGCCTCGTTCGGCAAGACTATCAACGACTAC
CAGCAGCTCTCGCGCCAGGAGCTTGTGCAGAAGAAGCAGGAAGAGGCCGTCGAGCGCATCAAGAAGTTCCGCCTC
GACCTGTCCGACTTTCGCTCCCAGATCGACGCTCTCAACAAGGTCCGCGAAGACGCCCAGCACCAGGCCAACAGG
AGCGAGCTTCTCGGCAGAAGACCCTACAATGCGACGCCCGAGAATCCGTACGCAAACGCCGCCGTTGGTCCCACG
CCGTCGGCCTTTCAGCCTCGGCAACCCGCGCATGCCGGCGGCTCGCTGACGACGGGTTCGGCGGACGAGGTTCGC
GAGGCTCACGCGTTTCGCGAACAAAACTTCCTCGCCAACACGAACCAGGCGCTCGACGACTACATCGCCAGGGGA
CAGGCCGTCCTGGGTGACCTGGGCCAGCAGCGCGAGATGCTCAAGAACACACAGAAGAGGCTGTACACCGTGGCC
AACACTCTGGGCGTCAGCGGAGACACTATTCGCATGGTCGAGCGGCGAGCGCGAGAGGACAAGTGGATCTTCTTC
GCCGGCGTCATCGCCTTCTTCCTGTTTTGCTGGCTCGTGCTACACTATCTGCGATGA
Transcript >Ophun1|431
ATGAACGTGCTATACAACTCGGCCCTGCGGCAGAGCAGGGCCATCCGCGCCGAGCTGGTCGAGCTCAATGCCAAG
GGCGCGCCGACGCCGGCCGAGATGGGCAATGTATCTGCATCTCTTGCCTCGTTCGGCAAGACTATCAACGACTAC
CAGCAGCTCTCGCGCCAGGAGCTTGTGCAGAAGAAGCAGGAAGAGGCCGTCGAGCGCATCAAGAAGTTCCGCCTC
GACCTGTCCGACTTTCGCTCCCAGATCGACGCTCTCAACAAGGTCCGCGAAGACGCCCAGCACCAGGCCAACAGG
AGCGAGCTTCTCGGCAGAAGACCCTACAATGCGACGCCCGAGAATCCGTACGCAAACGCCGCCGTTGGTCCCACG
CCGTCGGCCTTTCAGCCTCGGCAACCCGCGCATGCCGGCGGCTCGCTGACGACGGGTTCGGCGGACGAGGTTCGC
GAGGCTCACGCGTTTCGCGAACAAAACTTCCTCGCCAACACGAACCAGGCGCTCGACGACTACATCGCCAGGGGA
CAGGCCGTCCTGGGTGACCTGGGCCAGCAGCGCGAGATGCTCAAGAACACACAGAAGAGGCTGTACACCGTGGCC
AACACTCTGGGCGTCAGCGGAGACACTATTCGCATGGTCGAGCGGCGAGCGCGAGAGGACAAGTGGATCTTCTTC
GCCGGCGTCATCGCCTTCTTCCTGTTTTGCTGGCTCGTGCTACACTATCTGCGATGA
Gene >Ophun1|431
ATGGTACGAGACAGCGCTCGCCGATTGAGCGTTCCGCAGCTGACAGCCATGTTAGAACGTGCTATACAACTCGGC
CCTGCGGCAGAGCAGGGCCATCCGCGCCGAGCTGGTCGAGCTCAATGCCAAGGGCGCGCCGACGCCGGCCGAGAT
GGGCAATGTATCTGCATCTCTTGCCTCGTTCGGCAAGACTATCAACGACTACCAGCAGCTCTCGCGCCAGGAGCT
TGTGCAGAAGAAGCAGGAAGAGGCCGTCGAGCGCATCAAGAAGTTCCGCCTCGACCTGTCCGACTTTCGCTCCCA
GATCGACGCTCTCAACAAGGTCCGCGAAGACGCCCAGCACCAGGCCAACAGGAGCGAGCTTCTCGGCAGAAGACC
CTACAATGCGACGCCCGAGAATCCGTACGCAAACGCCGCCGTTGGTCCCACGCCGTCGGCCTTTCAGCCTCGGCA
ACCCGCGCATGCCGGCGGCTCGCTGACGACGGGTTCGGCGGACGAGGTTCGCGAGGCTCACGCGTTTCGCGAACA
AAACTTCCTCGCCAACACGAACCAGGCGCTCGACGACTACATCGCCAGGGGACAGGCCGTCCTGGGTGACCTGGG
CCAGCAGCGCGAGATGCTCAAGAACACACAGAAGAGGCTGTACACCGTGGCCAACACTCTGGGCGTCAGCGGAGA
CACTATTCGCATGGTCGAGCGGCGAGCGCGAGAGGACAAGTGGATCTTCTTCGCCGGCGTCATCGCCTTCTTCCT
GTTTTGCTGGCTCGTGCTACACTATCTGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail