Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4309
Gene name
LocationContig_399:16485..17126
Strand+
Gene length (bp)641
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06466|TDA6_YEAST Putative vacuolar protein sorting-associated protein TDA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA6 PE=2 SV=1 125 179 4.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4309
MGLQRWVRRSLVLATLLTSFILLAWYLPRALNPTETSPSKQLEDRLWVETSPYFWDRAACRWLGLCGVHHLRADP
AVRVEDGGVEEEEEEEEEEWLELRRRGVGEGDGKGKKKRRRTVKRRIVEDVPDYVLRFAPYVHLYSGEQFWPSDI
AEHVRHMNATDHHGNPLHHGLENINLDRLNLLDAGAYHSRRHPHP*
Coding >Ophun1|4309
ATGGGGCTGCAGCGGTGGGTGCGTCGCAGCCTCGTGCTGGCGACGCTGCTAACCTCGTTCATCCTGCTGGCCTGG
TATCTCCCGCGGGCGCTGAACCCGACGGAGACGAGTCCCTCGAAGCAGCTGGAGGACAGGCTGTGGGTCGAGACG
AGTCCGTATTTCTGGGATCGGGCTGCGTGTCGGTGGTTGGGTCTTTGCGGCGTCCATCACTTGCGGGCCGATCCG
GCGGTGAGGGTTGAGGATGGGGGTGTCGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGTGGCTTGAGTTGAGGAGG
AGGGGGGTGGGAGAGGGGGATGGGAAGGGGAAGAAGAAGAGGAGGAGGACGGTCAAGAGGAGGATTGTTGAGGAT
GTGCCCGACTATGTGCTGCGGTTTGCGCCGTATGTGCATCTTTACTCGGGGGAGCAGTTCTGGCCGTCGGATATA
GCGGAACATGTGCGGCACATGAACGCAACGGACCATCACGGAAACCCGCTTCACCACGGCCTCGAGAACATCAAC
CTCGATCGACTGAATCTCCTCGACGCGGGGGCCTATCACTCGCGACGGCATCCCCATCCATAA
Transcript >Ophun1|4309
ATGGGGCTGCAGCGGTGGGTGCGTCGCAGCCTCGTGCTGGCGACGCTGCTAACCTCGTTCATCCTGCTGGCCTGG
TATCTCCCGCGGGCGCTGAACCCGACGGAGACGAGTCCCTCGAAGCAGCTGGAGGACAGGCTGTGGGTCGAGACG
AGTCCGTATTTCTGGGATCGGGCTGCGTGTCGGTGGTTGGGTCTTTGCGGCGTCCATCACTTGCGGGCCGATCCG
GCGGTGAGGGTTGAGGATGGGGGTGTCGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGTGGCTTGAGTTGAGGAGG
AGGGGGGTGGGAGAGGGGGATGGGAAGGGGAAGAAGAAGAGGAGGAGGACGGTCAAGAGGAGGATTGTTGAGGAT
GTGCCCGACTATGTGCTGCGGTTTGCGCCGTATGTGCATCTTTACTCGGGGGAGCAGTTCTGGCCGTCGGATATA
GCGGAACATGTGCGGCACATGAACGCAACGGACCATCACGGAAACCCGCTTCACCACGGCCTCGAGAACATCAAC
CTCGATCGACTGAATCTCCTCGACGCGGGGGCCTATCACTCGCGACGGCATCCCCATCCATAA
Gene >Ophun1|4309
ATGGGGCTGCAGCGGTGGGTGCGTCGCAGCCTCGTGCTGGCGACGCTGCTAACCTCGTTCATCCTGCTGGCCTGG
TATCTCCCGCGGGCGCTGAACCCGACGGAGACGAGTCCCTCGAAGCAGCTGGAGGACAGGCTGTGGGTCGAGACG
AGTCCGTATTTCTGGGATCGGGCTGCGTGTCGGTGGTTGGGTCTTTGCGGCGTCCATCACTTGCGGGCCGATCCG
GCGGTGAGGGTTGAGGATGGGGGTGTCGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGTGGCTTGAGTTGAGGAGG
AGGGGGGTGGGAGAGGGGGATGGGAAGGGGAAGAAGAAGAGGAGGAGGACGGTCAAGAGGAGGATTGTTGAGGAT
GTGCCCGACTATGTGCTGCGGTTTGCGCCGTATGTGCATCTTTACTCGGGGGAGCAGTTCTGGCCGTCGGATATA
GCGGAACATGTGCGGCACATGAACGCAACGGACCATCACGGAAACCCGCTTCACCACGGCCTCGAGAACATCAAC
CTCGATCGACTGAATCTCCTCGACGCGGGGGCCTATCACGTCAACCTGCACAGCTTGGACGACGTCGAGGCTCGT
CCCGACTGGCTGTACAGTCGCGACGGCATCCCCATCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail