Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4306
Gene name
LocationContig_399:10377..11786
Strand+
Gene length (bp)1409
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02100 ODC_AZ Ornithine decarboxylase antizyme 1.3E-42 206 318

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008073 ornithine decarboxylase inhibitor activity Yes
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0003674 molecular_function No
GO:0042979 ornithine decarboxylase regulator activity No
GO:0004857 enzyme inhibitor activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3610
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1860
Ophiocordyceps australis map64 (Brazil) OphauB2|7335
Ophiocordyceps camponoti-floridani Ophcf2|02013
Ophiocordyceps camponoti-rufipedis Ophun1|4306 (this protein)
Ophiocordyceps kimflemingae Ophio5|3318
Ophiocordyceps subramaniannii Hirsu2|6966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4306
MHGATHSHWLGSRHLHEMPLSSLAVPIRIFSSTLEIAAVPSDPHPKRETMAPMNYQTLNCSSRYGEDVIAPRVNV
LASCYVVDSAANLKGLHYCTTGVAGLPSPPTSPPLAALTSSNKLALLPKHKKRDIPGRRLERRGGAALVIREECE
RFFCESMKTVFRGERDLLMYGSGLSGAFVQTPPPEDHIAAALDKGGDVDGAAVEVNAWMEVWDYAGGASFRAFVV
DDGDDKSLFVFFDVQGVLGRDLKRGLMALIELADGPLECGRIMTCIDRRIPAQEALELTRSLQWVGFDMATLDHW
AGDMDVTSPSWVLMGMEL*
Coding >Ophun1|4306
ATGCACGGCGCAACGCATTCTCATTGGCTGGGCAGCCGGCATCTCCACGAGATGCCGCTGTCCAGCCTCGCCGTC
CCGATCAGGATCTTCTCGTCGACTCTGGAGATTGCTGCCGTTCCATCCGATCCCCATCCGAAGCGAGAAACAATG
GCGCCCATGAATTATCAGACTTTGAATTGTAGTAGTCGCTATGGCGAGGACGTCATCGCTCCGCGCGTTAATGTC
CTTGCCTCCTGCTACGTCGTCGACTCTGCCGCCAACCTCAAAGGCCTCCACTACTGCACTACGGGGGTCGCAGGA
CTCCCATCACCTCCGACAAGCCCCCCCCTCGCCGCGCTGACCTCGTCCAACAAGCTCGCGCTTCTTCCCAAGCAC
AAGAAGCGTGACATTCCGGGCCGCCGCCTGGAGCGACGAGGGGGGGCAGCACTCGTGATCAGGGAAGAATGTGAG
AGATTCTTTTGCGAGTCCATGAAGACTGTGTTCCGTGGTGAGCGGGACCTGTTGATGTATGGCTCCGGCCTGTCC
GGTGCTTTTGTGCAAACACCACCGCCAGAGGACCACATTGCCGCTGCGCTCGACAAGGGCGGCGACGTCGATGGT
GCCGCCGTCGAGGTCAACGCCTGGATGGAGGTCTGGGACTATGCCGGCGGCGCCAGCTTCCGCGCCTTTGTCGTC
GACGACGGGGACGACAAGTCTCTGTTTGTCTTCTTCGACGTCCAAGGCGTCCTGGGTAGAGATTTGAAGAGAGGC
CTCATGGCTCTCATCGAACTCGCCGACGGCCCCTTGGAATGCGGCCGCATCATGACTTGCATCGACCGCCGCATC
CCGGCCCAGGAGGCGCTGGAGCTGACCAGGAGCCTGCAGTGGGTCGGCTTCGATATGGCTACTTTGGATCACTGG
GCGGGCGACATGGACGTCACCAGCCCCAGCTGGGTGCTGATGGGCATGGAACTTTGA
Transcript >Ophun1|4306
ATGCACGGCGCAACGCATTCTCATTGGCTGGGCAGCCGGCATCTCCACGAGATGCCGCTGTCCAGCCTCGCCGTC
CCGATCAGGATCTTCTCGTCGACTCTGGAGATTGCTGCCGTTCCATCCGATCCCCATCCGAAGCGAGAAACAATG
GCGCCCATGAATTATCAGACTTTGAATTGTAGTAGTCGCTATGGCGAGGACGTCATCGCTCCGCGCGTTAATGTC
CTTGCCTCCTGCTACGTCGTCGACTCTGCCGCCAACCTCAAAGGCCTCCACTACTGCACTACGGGGGTCGCAGGA
CTCCCATCACCTCCGACAAGCCCCCCCCTCGCCGCGCTGACCTCGTCCAACAAGCTCGCGCTTCTTCCCAAGCAC
AAGAAGCGTGACATTCCGGGCCGCCGCCTGGAGCGACGAGGGGGGGCAGCACTCGTGATCAGGGAAGAATGTGAG
AGATTCTTTTGCGAGTCCATGAAGACTGTGTTCCGTGGTGAGCGGGACCTGTTGATGTATGGCTCCGGCCTGTCC
GGTGCTTTTGTGCAAACACCACCGCCAGAGGACCACATTGCCGCTGCGCTCGACAAGGGCGGCGACGTCGATGGT
GCCGCCGTCGAGGTCAACGCCTGGATGGAGGTCTGGGACTATGCCGGCGGCGCCAGCTTCCGCGCCTTTGTCGTC
GACGACGGGGACGACAAGTCTCTGTTTGTCTTCTTCGACGTCCAAGGCGTCCTGGGTAGAGATTTGAAGAGAGGC
CTCATGGCTCTCATCGAACTCGCCGACGGCCCCTTGGAATGCGGCCGCATCATGACTTGCATCGACCGCCGCATC
CCGGCCCAGGAGGCGCTGGAGCTGACCAGGAGCCTGCAGTGGGTCGGCTTCGATATGGCTACTTTGGATCACTGG
GCGGGCGACATGGACGTCACCAGCCCCAGCTGGGTGCTGATGGGCATGGAACTTTGA
Gene >Ophun1|4306
ATGCACGGCGCAACGCATTCTCATTGGCTGGGCAGCCGGCATCTCCACGAGATGGTAGGCCCAGATTACTGTGCT
GAGACTGTGCCAAGACCCCTGACGACCACCGATTGAGAATGCCGCATCCAATCAAAAATGCAGCCCGAAACAGCA
ACCCGCTGCGCCACTACCCTTTCTGCGCACTGTGCGTCGTCTCAGCCACCCTCCGGCTCGCTCAGGTGACCAGCC
AAAACGGCGCCTAATTCTTCTTCCGCTTCCCACCCTTTTCTTCCCCCTCTCCATCTGATTCTCTAGACTTTCAAC
CTCCCAACAGGGCAGTTCCGTCAACGAAAAATCCCCCGTGTCTCATTCATCACGCGCTTCTCTCAGCCGCTGTCC
AGCCTCGCCGTCCCGATCAGGATCTTCTCGTCGACTCTGGAGATTGCTGCCGTTCCATCCGATCCCCATCCGAAG
CGAGAAACAATGGCGCCCATGAATTATCAGACTTTGAATTGTAGTAGTCGCTATGGCGAGGACGTCATCGCTCCG
CGCGTTAATGTCCTTGCCTCCTGCTACGTCGTCGACTCTGCCGCCAACCTCAAAGGCCTCCACTACTGCACTACG
GGGGTCGCAGGTGAGCCCAGTCCCCGTCGTCTCCCTGTACGACACAGCTGACCCTTCTGTCTTCCAGGGGCGGAG
TGGTATTCCTGAGGTCCCTACCTCAGGACTCCCATCACCTCCGACAAGCCCCCCCCTCGCCGCGCTGACCTCGTC
CAACAAGCTCGCGCTTCTTCCCAAGCACAAGAAGCGTGACATTCCGGGCCGCCGCCTGGAGCGACGAGGGGGGGC
AGCACTCGTGATCAGGGAAGAATGTGAGAGATTCTTTTGCGAGTCCATGAAGACTGTGTTCCGTGGTGAGCGGGA
CCTGTTGATGTATGGCTCCGGCCTGTCCGGTGCTTTTGTGCAAACACCACCGCCAGAGGACCACATTGCCGCTGC
GCTCGACAAGGGCGGCGACGTCGATGGTGCCGCCGTCGAGGTCAACGCCTGGATGGAGGTCTGGGACTATGCCGG
CGGCGCCAGCTTCCGCGCCTTTGTCGTCGACGACGGGGACGACAAGTCTCTGTTTGTCTTCTTCGACGTCCAAGG
CGTCCTGGGTAGAGATTTGAAGAGAGGGTAAGTCTCCCGGAGTGTCTGTCTACAACCTGTCGCTGACTCCTCCCA
GCCTCATGGCTCTCATCGAACTCGCCGACGGCCCCTTGGAATGCGGCCGCATCATGACTTGCATCGACCGCCGCA
TCCCGGCCCAGGAGGCGCTGGAGCTGACCAGGAGCCTGCAGTGGGTCGGCTTCGATATGGCTACTTTGGATCACT
GGGCGGGCGACATGGACGTCACCAGCCCCAGCTGGGTGCTGATGGGCATGGAACTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail