Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4302
Gene name
LocationContig_398:13415..16423
Strand+
Gene length (bp)3008
Transcript length (bp)2949
Coding sequence length (bp)2949
Protein length (aa) 983

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 2.3E-81 608 910
PF16486 ArgoN N-terminal domain of argonaute 5.1E-19 85 226
PF08699 ArgoL1 Argonaute linker 1 domain 5.3E-13 236 293
PF16488 ArgoL2 Argonaute linker 2 domain 3.1E-12 462 506
PF02170 PAZ PAZ domain 4.3E-09 345 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 83 919 5.0E-117
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 67 917 1.0E-104
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 67 926 3.0E-103
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 72 917 6.0E-103
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 81 908 3.0E-101
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74957|AGO1_SCHPO Protein argonaute OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ago1 PE=1 SV=1 83 919 5.0E-117
sp|Q7XSA2|AGO1B_ORYSJ Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B PE=2 SV=3 67 917 1.0E-104
sp|Q6EU14|AGO1A_ORYSJ Protein argonaute 1A OS=Oryza sativa subsp. japonica GN=AGO1A PE=2 SV=1 67 926 3.0E-103
sp|O04379|AGO1_ARATH Protein argonaute 1 OS=Arabidopsis thaliana GN=AGO1 PE=1 SV=1 72 917 6.0E-103
sp|Q9SJK3|AGO5_ARATH Protein argonaute 5 OS=Arabidopsis thaliana GN=AGO5 PE=1 SV=2 81 908 3.0E-101
sp|Q6K972|AGO1C_ORYSJ Protein argonaute 1C OS=Oryza sativa subsp. japonica GN=AGO1C PE=2 SV=1 57 948 4.0E-101
sp|Q9XGW1|AGO10_ARATH Protein argonaute 10 OS=Arabidopsis thaliana GN=AGO10 PE=2 SV=1 81 908 4.0E-95
sp|Q7Y001|AGO12_ORYSJ Protein argonaute 12 OS=Oryza sativa subsp. japonica GN=AGO12 PE=2 SV=2 79 908 2.0E-94
sp|Q5Z5B2|AGO1D_ORYSJ Protein argonaute 1D OS=Oryza sativa subsp. japonica GN=AGO1D PE=2 SV=1 83 908 4.0E-93
sp|Q851R2|MEL1_ORYSJ Protein argonaute MEL1 OS=Oryza sativa subsp. japonica GN=MEL1 PE=2 SV=1 83 931 2.0E-92
sp|Q69VD5|PNH1_ORYSJ Protein argonaute PNH1 OS=Oryza sativa subsp. japonica GN=PHN1 PE=2 SV=1 81 917 2.0E-90
sp|Q9QZ81|AGO2_RAT Protein argonaute-2 OS=Rattus norvegicus GN=Ago2 PE=2 SV=2 79 910 7.0E-89
sp|O77503|AGO2_RABIT Protein argonaute-2 (Fragment) OS=Oryctolagus cuniculus GN=AGO2 PE=1 SV=2 79 910 1.0E-88
sp|Q9UKV8|AGO2_HUMAN Protein argonaute-2 OS=Homo sapiens GN=AGO2 PE=1 SV=3 79 910 1.0E-88
sp|Q8CJG0|AGO2_MOUSE Protein argonaute-2 OS=Mus musculus GN=Ago2 PE=1 SV=3 79 910 1.0E-88
sp|Q6QME8|AGO2_BOVIN Protein argonaute-2 OS=Bos taurus GN=AGO2 PE=2 SV=1 79 910 6.0E-88
sp|Q6DCX2|AGO2_XENLA Protein argonaute-2 OS=Xenopus laevis GN=ago2 PE=2 SV=1 79 934 4.0E-87
sp|Q6DJB9|AGO2_XENTR Protein argonaute-2 OS=Xenopus tropicalis GN=ago2 PE=2 SV=1 79 934 4.0E-84
sp|Q69UP6|AGO18_ORYSJ Protein argonaute 18 OS=Oryza sativa subsp. japonica GN=AGO18 PE=2 SV=1 83 908 1.0E-83
sp|A3KPK0|AGO3_DANRE Protein argonaute-3 OS=Danio rerio GN=ago3 PE=3 SV=1 81 910 2.0E-83
sp|Q8CJG1|AGO1_MOUSE Protein argonaute-1 OS=Mus musculus GN=Ago1 PE=1 SV=2 63 910 3.0E-82
sp|Q9UL18|AGO1_HUMAN Protein argonaute-1 OS=Homo sapiens GN=AGO1 PE=1 SV=3 63 910 3.0E-82
sp|Q6Z4F1|AGO14_ORYSJ Protein argonaute 14 OS=Oryza sativa subsp. japonica GN=AGO14 PE=2 SV=1 81 925 1.0E-81
sp|Q84VQ0|AGO9_ARATH Protein argonaute 9 OS=Arabidopsis thaliana GN=AGO9 PE=1 SV=2 81 906 1.0E-81
sp|Q8CJF9|AGO3_MOUSE Protein argonaute-3 OS=Mus musculus GN=Ago3 PE=2 SV=2 81 910 4.0E-81
sp|Q9H9G7|AGO3_HUMAN Protein argonaute-3 OS=Homo sapiens GN=AGO3 PE=1 SV=2 65 910 7.0E-81
sp|Q5ZLG4|AGO3_CHICK Protein argonaute-3 OS=Gallus gallus GN=AGO3 PE=2 SV=1 81 910 2.0E-80
sp|Q75HC2|AGO7_ORYSJ Protein argonaute 7 OS=Oryza sativa subsp. japonica GN=AGO7 PE=2 SV=2 72 920 2.0E-79
sp|Q9C793|AGO7_ARATH Protein argonaute 7 OS=Arabidopsis thaliana GN=AGO7 PE=2 SV=1 82 910 4.0E-79
sp|Q0JF58|AGO4B_ORYSJ Protein argonaute 4B OS=Oryza sativa subsp. japonica GN=AGO4B PE=2 SV=1 79 943 4.0E-78
sp|Q6T5B7|AGO3_BOVIN Protein argonaute-3 OS=Bos taurus GN=AGO3 PE=2 SV=2 81 910 4.0E-78
sp|Q4KLV6|AGO4_XENLA Protein argonaute-4 OS=Xenopus laevis GN=ago4 PE=2 SV=1 79 910 7.0E-78
sp|Q6YSJ5|AGO16_ORYSJ Protein argonaute 16 OS=Oryza sativa subsp. japonica GN=AGO16 PE=2 SV=2 82 906 1.0E-77
sp|Q9HCK5|AGO4_HUMAN Protein argonaute-4 OS=Homo sapiens GN=AGO4 PE=1 SV=2 79 910 2.0E-76
sp|Q9ZVD5|AGO4_ARATH Protein argonaute 4 OS=Arabidopsis thaliana GN=AGO4 PE=1 SV=2 81 906 4.0E-76
sp|Q5ZMW0|AGO4_CHICK Protein argonaute-4 OS=Gallus gallus GN=AGO4 PE=2 SV=1 145 910 9.0E-76
sp|Q8CJF8|AGO4_MOUSE Protein argonaute-4 OS=Mus musculus GN=Ago4 PE=2 SV=2 79 910 3.0E-75
sp|Q9SHF3|AGO2_ARATH Protein argonaute 2 OS=Arabidopsis thaliana GN=AGO2 PE=1 SV=1 11 917 1.0E-74
sp|Q9SDG8|AGO4A_ORYSJ Protein argonaute 4A OS=Oryza sativa subsp. japonica GN=AGO4A PE=2 SV=1 186 907 1.0E-73
sp|Q10F39|AGO11_ORYSJ Protein argonaute 11 OS=Oryza sativa subsp. japonica GN=AGO11 PE=2 SV=2 333 908 3.0E-73
sp|P34681|TAG76_CAEEL Putative protein tag-76 OS=Caenorhabditis elegans GN=tag-76 PE=3 SV=2 398 910 9.0E-73
sp|Q852N2|AGO13_ORYSJ Protein argonaute 13 OS=Oryza sativa subsp. japonica GN=AGO13 PE=2 SV=1 232 931 1.0E-72
sp|Q7XTS4|AGO2_ORYSJ Protein argonaute 2 OS=Oryza sativa subsp. japonica GN=AGO2 PE=2 SV=2 222 910 2.0E-69
sp|Q9SHF2|AGO3_ARATH Protein argonaute 3 OS=Arabidopsis thaliana GN=AGO3 PE=3 SV=1 19 910 6.0E-68
sp|Q7XTS3|AGO3_ORYSJ Protein argonaute 3 OS=Oryza sativa subsp. japonica GN=AGO3 PE=2 SV=2 120 910 2.0E-67
sp|O48771|AGO6_ARATH Protein argonaute 6 OS=Arabidopsis thaliana GN=AGO6 PE=2 SV=2 79 907 2.0E-66
sp|Q3E984|AGO8_ARATH Protein argonaute 8 OS=Arabidopsis thaliana GN=AGO8 PE=3 SV=1 75 906 1.0E-65
sp|Q5NBN9|AGO15_ORYSJ Protein argonaute 15 OS=Oryza sativa subsp. japonica GN=AGO15 PE=2 SV=2 396 923 1.0E-63
sp|Q6H6C3|AGO17_ORYSJ Protein argonaute 17 OS=Oryza sativa subsp. japonica GN=AGO17 PE=2 SV=1 411 910 1.0E-57
sp|Q9VUQ5|AGO2_DROME Protein argonaute-2 OS=Drosophila melanogaster GN=AGO2 PE=1 SV=3 78 910 4.0E-57
sp|O61931|ERGO1_CAEEL Piwi-like protein ergo-1 OS=Caenorhabditis elegans GN=ergo-1 PE=1 SV=2 382 908 2.0E-35
sp|Q7PLK0|AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster GN=AGO3 PE=1 SV=3 606 901 4.0E-28
sp|Q7Z3Z3|PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens GN=PIWIL3 PE=2 SV=2 460 901 2.0E-26
sp|Q96J94|PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens GN=PIWIL1 PE=1 SV=1 460 916 6.0E-26
sp|Q8UVX0|PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1 365 901 6.0E-26
sp|Q8CGT6|PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus GN=Piwil4 PE=1 SV=3 466 901 2.0E-25
sp|Q9VKM1|PIWI_DROME Protein piwi OS=Drosophila melanogaster GN=piwi PE=1 SV=1 356 884 3.0E-25
sp|A6N7Y9|PIWL1_CHICK Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1 388 917 5.0E-25
sp|Q9JMB7|PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus GN=Piwil1 PE=1 SV=1 460 916 6.0E-25
sp|Q09249|YQ53_CAEEL Uncharacterized protein C16C10.3 OS=Caenorhabditis elegans GN=C16C10.3 PE=3 SV=1 384 913 8.0E-25
sp|Q4G033|PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus GN=Piwil4 PE=2 SV=2 466 901 9.0E-25
sp|O76922|AUB_DROME Protein aubergine OS=Drosophila melanogaster GN=aub PE=1 SV=1 390 921 7.0E-24
sp|Q7Z3Z4|PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens GN=PIWIL4 PE=2 SV=2 67 901 4.0E-22
sp|A2CEI6|PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio GN=piwil2 PE=1 SV=2 606 917 5.0E-21
sp|Q8TC59|PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens GN=PIWIL2 PE=1 SV=1 460 901 1.0E-20
sp|Q21770|WAGO1_CAEEL Argonaute protein wago-1 OS=Caenorhabditis elegans GN=wago-1 PE=1 SV=1 384 908 2.0E-20
sp|Q8CDG1|PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus GN=Piwil2 PE=1 SV=2 460 901 3.0E-20
sp|A6P7L8|PIWL2_ONCMY Piwi-like protein 2 OS=Oncorhynchus mykiss GN=piwil2 PE=2 SV=1 606 901 1.0E-19
sp|A8KBF3|PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis GN=piwil2 PE=1 SV=1 582 901 2.0E-19
sp|Q2Q5Y8|PIWI2_SCHMD Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1 626 921 2.0E-18
sp|Q2PC95|PIWIL_DUGJA Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1 626 911 1.0E-14
sp|Q2Q5Y9|PIWI1_SCHMD Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1 633 914 1.0E-13
sp|Q21691|NRDE3_CAEEL Nuclear RNAi defective-3 protein OS=Caenorhabditis elegans GN=nrde-3 PE=1 SV=1 383 915 2.0E-12
sp|Q86QW7|AGO_GIAIN Protein argonaute OS=Giardia intestinalis GN=Ago PE=1 SV=2 596 901 3.0E-08
sp|A8BCK6|AGO_GIAIC Protein argonaute OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=Ago PE=3 SV=1 596 901 4.0E-08
sp|C6LTG5|AGO_GIAIB Protein argonaute OS=Giardia intestinalis (strain ATCC 50581 / GS clone H7) GN=Ago PE=3 SV=1 633 902 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup860
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3044
Ophiocordyceps australis map64 (Brazil) OphauB2|2045
Ophiocordyceps camponoti-floridani Ophcf2|05274
Ophiocordyceps camponoti-rufipedis Ophun1|3281
Ophiocordyceps camponoti-rufipedis Ophun1|4302 (this protein)
Ophiocordyceps kimflemingae Ophio5|1233
Ophiocordyceps subramaniannii Hirsu2|48

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4302
MSDRGRSPPPAGSRGASPTRSASGSQPGAPGGRVVPLGFDPAKPASKPDNKGNTRMELPADAYVADTQKSIFALR
GNKLNTEGKPAIIEVNQYRMKTFDFSKKIYQYDVTISPDLDKKAVVLKKIWSHEATKQALSKYKFEAWLFDGRKL
AWAPAQVDRGEVRYQVDLDEGRKPPASGTRRDNNKFFVSIRQTTVVNMSALQGYLQQKISFNTSVQTAMNFIDHL
LRQAPSQRLLSIKRNFYDQTLRGKPLSAVGSYIEAHKGLYASVRLSQNLNLGGMGLALNADVANTCFWVGGLSMD
QLMINFLGACERKWSGLTPVTAVQHLKPVKHHSGSWASSDAFKQLRKLRRLKFTVRHPNRVNPEKLYTIVDFAFK
PEYGPDGGNAKNVTFDYENGKISVENFFAKKYKAHLRYSLLPVIDAGKNGYIPMEFAVVAPMQRYPFKLNPDQTS
AMIKFAVTRPRERRADIERGVASLRFNEDPYLREYGVKFEPSFTKVEAKVLPPPRVDFSTGNADPKFSGRWDLRG
KKFWKQNLAPLENWAFIVLDGCVDFNSLQAFAKSFRTAFLGHGGKCPADALLLNVPANFKHNAAEALAWAHNEIK
AKRGYTQLIFVVVAHKNSPHYERLKKSADCRFGILSQVVNGDHVKKNNGQYLSNVAMKVNAKLGGATSRTMPPWK
SQTFFPKDRPTMMIGVDVSHGAPGSNAPSTAAMTMSVDRDATRYAAMVETNGFRVEILTAANVHFLFGQLADEWK
KGHEGAFPKHIVYFRDGVSEGQFSQVIDQEISEIRCFFRSKAPQMPMPKFTVVVATKRHHIRFFPGQGDKNGNAL
PGTLVEKEVTHPFMWDFYMCSHVAIQGTARPVHYHVILDEMNVPVNDFQKMIYHQCYSYARSTTPVSLHPAVYYA
HLAGARARAHENIATSEGFRSGAKGHEMIRDQVAKGATIGSIPSGTESPALLTLGGRVNPDKGPDPGEQRQRDFF
RSTMWYI*
Coding >Ophun1|4302
ATGTCGGACAGAGGCCGCTCGCCTCCGCCTGCGGGCAGTCGTGGCGCCTCGCCAACTCGATCTGCCTCGGGCTCT
CAGCCTGGCGCTCCGGGTGGACGAGTTGTGCCGTTGGGCTTCGACCCAGCAAAGCCGGCCAGCAAGCCGGACAAC
AAGGGAAACACGCGCATGGAACTTCCCGCCGACGCCTATGTTGCCGACACCCAGAAGAGCATCTTTGCTCTTCGC
GGCAACAAGTTGAACACGGAGGGCAAGCCTGCCATCATCGAGGTCAACCAGTATCGCATGAAGACTTTTGACTTC
AGCAAGAAGATTTACCAGTACGACGTGACCATCTCGCCGGACTTGGACAAGAAGGCCGTGGTCCTTAAGAAGATT
TGGTCGCACGAAGCGACGAAGCAGGCCCTTTCCAAGTACAAGTTCGAGGCCTGGCTCTTTGATGGCCGAAAGCTT
GCCTGGGCGCCCGCTCAGGTCGACCGTGGCGAGGTCCGATACCAGGTCGACTTGGATGAGGGTCGCAAGCCTCCT
GCCAGCGGCACCAGGAGGGACAACAACAAGTTCTTCGTCAGCATCCGTCAGACGACTGTGGTCAACATGTCGGCC
CTTCAAGGTTATCTTCAACAGAAGATATCATTCAACACCAGCGTCCAGACGGCGATGAACTTCATCGACCATTTG
CTGCGCCAGGCGCCGTCTCAGCGCCTCTTGTCGATAAAGCGGAACTTTTACGACCAGACGCTGAGGGGCAAGCCT
CTGTCGGCTGTTGGCAGTTACATCGAGGCTCACAAGGGGCTGTACGCCTCGGTTCGCCTCAGCCAGAATCTCAAC
CTGGGCGGCATGGGCCTCGCCCTCAACGCGGATGTGGCCAATACATGCTTCTGGGTTGGCGGCTTGTCGATGGAT
CAATTGATGATCAACTTCTTGGGCGCCTGCGAGCGCAAGTGGAGCGGCTTGACTCCCGTCACTGCCGTTCAGCAT
CTCAAGCCCGTCAAGCACCACAGCGGCTCTTGGGCATCTTCCGATGCCTTCAAACAGCTTCGAAAGCTCAGACGT
CTCAAGTTCACTGTTCGCCACCCTAACAGGGTCAACCCGGAGAAGTTGTATACCATCGTCGACTTTGCCTTCAAG
CCTGAGTACGGCCCCGACGGCGGTAACGCCAAGAATGTGACTTTCGACTACGAAAACGGCAAGATCTCGGTCGAA
AACTTCTTTGCGAAGAAGTACAAGGCTCATCTTCGCTACTCTCTGCTGCCCGTCATCGACGCAGGAAAGAATGGA
TACATCCCGATGGAGTTCGCCGTCGTCGCGCCCATGCAGCGATACCCGTTCAAGCTCAACCCGGATCAGACGTCG
GCCATGATCAAGTTTGCCGTGACGCGTCCTCGCGAACGTCGAGCCGACATCGAGCGTGGCGTGGCATCTCTGCGT
TTCAACGAGGACCCCTACCTCCGGGAGTATGGCGTCAAGTTTGAGCCGTCATTCACCAAGGTTGAGGCCAAGGTC
CTACCTCCGCCTCGCGTCGACTTCAGCACCGGCAACGCCGATCCCAAGTTCTCGGGCCGCTGGGATCTTCGCGGC
AAGAAATTCTGGAAGCAGAACCTGGCGCCCTTGGAGAACTGGGCTTTCATCGTGCTCGACGGCTGTGTCGACTTC
AACTCGCTCCAGGCCTTTGCCAAGTCGTTTCGAACGGCTTTCCTCGGCCATGGAGGCAAGTGTCCGGCCGATGCT
CTCCTGCTCAACGTGCCGGCCAACTTCAAGCACAACGCCGCCGAGGCTCTCGCCTGGGCTCATAACGAGATCAAG
GCCAAGCGCGGCTACACGCAACTGATCTTCGTGGTCGTCGCCCACAAGAACAGCCCGCACTACGAGCGACTGAAG
AAGTCGGCCGACTGCCGCTTCGGCATCTTGTCACAGGTGGTCAACGGCGATCACGTCAAGAAGAACAACGGCCAG
TACCTGTCCAACGTGGCCATGAAGGTCAACGCCAAGCTCGGCGGCGCCACGTCGCGCACGATGCCCCCCTGGAAG
AGCCAGACCTTCTTCCCCAAGGACCGACCGACCATGATGATTGGCGTCGACGTTTCGCATGGCGCTCCGGGTAGC
AACGCGCCGTCGACGGCGGCCATGACCATGTCGGTTGACCGCGACGCGACTCGATACGCCGCCATGGTCGAGACC
AACGGCTTCCGCGTCGAGATTCTCACGGCGGCCAACGTTCATTTCCTATTTGGACAGCTCGCCGATGAGTGGAAA
AAGGGCCACGAAGGCGCCTTTCCCAAGCACATTGTCTACTTCCGAGATGGCGTCTCCGAGGGACAGTTTTCGCAA
GTGATCGACCAAGAAATCTCTGAGATTCGCTGCTTCTTCCGGTCTAAGGCGCCCCAGATGCCGATGCCCAAGTTC
ACCGTTGTGGTGGCCACCAAGCGCCACCATATCCGCTTCTTCCCCGGCCAGGGCGACAAGAACGGCAACGCGCTT
CCGGGTACTCTCGTTGAGAAAGAGGTCACACATCCCTTCATGTGGGACTTTTACATGTGCTCCCACGTCGCCATC
CAGGGCACCGCACGCCCCGTCCATTACCACGTCATCCTGGATGAGATGAACGTGCCGGTCAATGACTTTCAGAAG
ATGATCTATCATCAGTGCTACAGTTACGCCAGATCGACGACGCCCGTGTCGCTGCATCCGGCCGTCTACTACGCA
CATCTGGCTGGAGCGCGGGCCCGGGCTCACGAGAACATCGCCACGTCGGAGGGCTTCCGATCCGGAGCCAAGGGT
CACGAGATGATCCGCGACCAGGTCGCCAAGGGGGCCACCATCGGCAGTATCCCCAGCGGCACCGAGTCGCCTGCC
CTTTTGACGCTGGGCGGAAGAGTCAACCCGGACAAGGGCCCGGACCCAGGCGAGCAGCGACAGCGGGACTTCTTC
CGCAGTACCATGTGGTACATCTGA
Transcript >Ophun1|4302
ATGTCGGACAGAGGCCGCTCGCCTCCGCCTGCGGGCAGTCGTGGCGCCTCGCCAACTCGATCTGCCTCGGGCTCT
CAGCCTGGCGCTCCGGGTGGACGAGTTGTGCCGTTGGGCTTCGACCCAGCAAAGCCGGCCAGCAAGCCGGACAAC
AAGGGAAACACGCGCATGGAACTTCCCGCCGACGCCTATGTTGCCGACACCCAGAAGAGCATCTTTGCTCTTCGC
GGCAACAAGTTGAACACGGAGGGCAAGCCTGCCATCATCGAGGTCAACCAGTATCGCATGAAGACTTTTGACTTC
AGCAAGAAGATTTACCAGTACGACGTGACCATCTCGCCGGACTTGGACAAGAAGGCCGTGGTCCTTAAGAAGATT
TGGTCGCACGAAGCGACGAAGCAGGCCCTTTCCAAGTACAAGTTCGAGGCCTGGCTCTTTGATGGCCGAAAGCTT
GCCTGGGCGCCCGCTCAGGTCGACCGTGGCGAGGTCCGATACCAGGTCGACTTGGATGAGGGTCGCAAGCCTCCT
GCCAGCGGCACCAGGAGGGACAACAACAAGTTCTTCGTCAGCATCCGTCAGACGACTGTGGTCAACATGTCGGCC
CTTCAAGGTTATCTTCAACAGAAGATATCATTCAACACCAGCGTCCAGACGGCGATGAACTTCATCGACCATTTG
CTGCGCCAGGCGCCGTCTCAGCGCCTCTTGTCGATAAAGCGGAACTTTTACGACCAGACGCTGAGGGGCAAGCCT
CTGTCGGCTGTTGGCAGTTACATCGAGGCTCACAAGGGGCTGTACGCCTCGGTTCGCCTCAGCCAGAATCTCAAC
CTGGGCGGCATGGGCCTCGCCCTCAACGCGGATGTGGCCAATACATGCTTCTGGGTTGGCGGCTTGTCGATGGAT
CAATTGATGATCAACTTCTTGGGCGCCTGCGAGCGCAAGTGGAGCGGCTTGACTCCCGTCACTGCCGTTCAGCAT
CTCAAGCCCGTCAAGCACCACAGCGGCTCTTGGGCATCTTCCGATGCCTTCAAACAGCTTCGAAAGCTCAGACGT
CTCAAGTTCACTGTTCGCCACCCTAACAGGGTCAACCCGGAGAAGTTGTATACCATCGTCGACTTTGCCTTCAAG
CCTGAGTACGGCCCCGACGGCGGTAACGCCAAGAATGTGACTTTCGACTACGAAAACGGCAAGATCTCGGTCGAA
AACTTCTTTGCGAAGAAGTACAAGGCTCATCTTCGCTACTCTCTGCTGCCCGTCATCGACGCAGGAAAGAATGGA
TACATCCCGATGGAGTTCGCCGTCGTCGCGCCCATGCAGCGATACCCGTTCAAGCTCAACCCGGATCAGACGTCG
GCCATGATCAAGTTTGCCGTGACGCGTCCTCGCGAACGTCGAGCCGACATCGAGCGTGGCGTGGCATCTCTGCGT
TTCAACGAGGACCCCTACCTCCGGGAGTATGGCGTCAAGTTTGAGCCGTCATTCACCAAGGTTGAGGCCAAGGTC
CTACCTCCGCCTCGCGTCGACTTCAGCACCGGCAACGCCGATCCCAAGTTCTCGGGCCGCTGGGATCTTCGCGGC
AAGAAATTCTGGAAGCAGAACCTGGCGCCCTTGGAGAACTGGGCTTTCATCGTGCTCGACGGCTGTGTCGACTTC
AACTCGCTCCAGGCCTTTGCCAAGTCGTTTCGAACGGCTTTCCTCGGCCATGGAGGCAAGTGTCCGGCCGATGCT
CTCCTGCTCAACGTGCCGGCCAACTTCAAGCACAACGCCGCCGAGGCTCTCGCCTGGGCTCATAACGAGATCAAG
GCCAAGCGCGGCTACACGCAACTGATCTTCGTGGTCGTCGCCCACAAGAACAGCCCGCACTACGAGCGACTGAAG
AAGTCGGCCGACTGCCGCTTCGGCATCTTGTCACAGGTGGTCAACGGCGATCACGTCAAGAAGAACAACGGCCAG
TACCTGTCCAACGTGGCCATGAAGGTCAACGCCAAGCTCGGCGGCGCCACGTCGCGCACGATGCCCCCCTGGAAG
AGCCAGACCTTCTTCCCCAAGGACCGACCGACCATGATGATTGGCGTCGACGTTTCGCATGGCGCTCCGGGTAGC
AACGCGCCGTCGACGGCGGCCATGACCATGTCGGTTGACCGCGACGCGACTCGATACGCCGCCATGGTCGAGACC
AACGGCTTCCGCGTCGAGATTCTCACGGCGGCCAACGTTCATTTCCTATTTGGACAGCTCGCCGATGAGTGGAAA
AAGGGCCACGAAGGCGCCTTTCCCAAGCACATTGTCTACTTCCGAGATGGCGTCTCCGAGGGACAGTTTTCGCAA
GTGATCGACCAAGAAATCTCTGAGATTCGCTGCTTCTTCCGGTCTAAGGCGCCCCAGATGCCGATGCCCAAGTTC
ACCGTTGTGGTGGCCACCAAGCGCCACCATATCCGCTTCTTCCCCGGCCAGGGCGACAAGAACGGCAACGCGCTT
CCGGGTACTCTCGTTGAGAAAGAGGTCACACATCCCTTCATGTGGGACTTTTACATGTGCTCCCACGTCGCCATC
CAGGGCACCGCACGCCCCGTCCATTACCACGTCATCCTGGATGAGATGAACGTGCCGGTCAATGACTTTCAGAAG
ATGATCTATCATCAGTGCTACAGTTACGCCAGATCGACGACGCCCGTGTCGCTGCATCCGGCCGTCTACTACGCA
CATCTGGCTGGAGCGCGGGCCCGGGCTCACGAGAACATCGCCACGTCGGAGGGCTTCCGATCCGGAGCCAAGGGT
CACGAGATGATCCGCGACCAGGTCGCCAAGGGGGCCACCATCGGCAGTATCCCCAGCGGCACCGAGTCGCCTGCC
CTTTTGACGCTGGGCGGAAGAGTCAACCCGGACAAGGGCCCGGACCCAGGCGAGCAGCGACAGCGGGACTTCTTC
CGCAGTACCATGTGGTACATCTGA
Gene >Ophun1|4302
ATGTCGGACAGAGGCCGCTCGCCTCCGCCTGCGGGCAGTCGTGGCGCCTCGCCAACTCGATCTGCCTCGGGCTCT
CAGCCTGGCGCTCCGGGTGGACGAGTTGTGCCGTTGGGCTTCGACCCAGCAAAGCCGGCCAGCAAGCCGGACAAC
AAGGGAAACACGCGCATGGAACTTCCCGCCGACGCCTATGTTGCCGACACCCAGAAGAGCATCTTTGCTCTTCGC
GGCAACAAGTTGAACACGGAGGGCAAGCCTGCCATCATCGAGGTCAACCAGTATCGCATGAAGACTTTTGACTTC
AGCAAGAAGATTTACCAGTACGACGTGAGTATCTCCCCTGCATCTCCCCTTCTGTGTCCCGCCTCAAGCTCACAT
CATTGCAGGTGACCATCTCGCCGGACTTGGACAAGAAGGCCGTGGTCCTTAAGAAGATTTGGTCGCACGAAGCGA
CGAAGCAGGCCCTTTCCAAGTACAAGTTCGAGGCCTGGCTCTTTGATGGCCGAAAGCTTGCCTGGGCGCCCGCTC
AGGTCGACCGTGGCGAGGTCCGATACCAGGTCGACTTGGATGAGGGTCGCAAGCCTCCTGCCAGCGGCACCAGGA
GGGACAACAACAAGTTCTTCGTCAGCATCCGTCAGACGACTGTGGTCAACATGTCGGCCCTTCAAGGTTATCTTC
AACAGAAGATATCATTCAACACCAGCGTCCAGACGGCGATGAACTTCATCGACCATTTGCTGCGCCAGGCGCCGT
CTCAGCGCCTCTTGTCGATAAAGCGGAACTTTTACGACCAGACGCTGAGGGGCAAGCCTCTGTCGGCTGTTGGCA
GTTACATCGAGGCTCACAAGGGGCTGTACGCCTCGGTTCGCCTCAGCCAGAATCTCAACCTGGGCGGCATGGGCC
TCGCCCTCAACGCGGATGTGGCCAATACATGCTTCTGGGTTGGCGGCTTGTCGATGGATCAATTGATGATCAACT
TCTTGGGCGCCTGCGAGCGCAAGTGGAGCGGCTTGACTCCCGTCACTGCCGTTCAGCATCTCAAGCCCGTCAAGC
ACCACAGCGGCTCTTGGGCATCTTCCGATGCCTTCAAACAGCTTCGAAAGCTCAGACGTCTCAAGTTCACTGTTC
GCCACCCTAACAGGGTCAACCCGGAGAAGTTGTATACCATCGTCGACTTTGCCTTCAAGCCTGAGTACGGCCCCG
ACGGCGGTAACGCCAAGAATGTGACTTTCGACTACGAAAACGGCAAGATCTCGGTCGAAAACTTCTTTGCGAAGA
AGTACAAGGCTCATCTTCGCTACTCTCTGCTGCCCGTCATCGACGCAGGAAAGAATGGATACATCCCGATGGAGT
TCGCCGTCGTCGCGCCCATGCAGCGATACCCGTTCAAGCTCAACCCGGATCAGACGTCGGCCATGATCAAGTTTG
CCGTGACGCGTCCTCGCGAACGTCGAGCCGACATCGAGCGTGGCGTGGCATCTCTGCGTTTCAACGAGGACCCCT
ACCTCCGGGAGTATGGCGTCAAGTTTGAGCCGTCATTCACCAAGGTTGAGGCCAAGGTCCTACCTCCGCCTCGCG
TCGACTTCAGCACCGGCAACGCCGATCCCAAGTTCTCGGGCCGCTGGGATCTTCGCGGCAAGAAATTCTGGAAGC
AGAACCTGGCGCCCTTGGAGAACTGGGCTTTCATCGTGCTCGACGGCTGTGTCGACTTCAACTCGCTCCAGGCCT
TTGCCAAGTCGTTTCGAACGGCTTTCCTCGGCCATGGAGGCAAGTGTCCGGCCGATGCTCTCCTGCTCAACGTGC
CGGCCAACTTCAAGCACAACGCCGCCGAGGCTCTCGCCTGGGCTCATAACGAGATCAAGGCCAAGCGCGGCTACA
CGCAACTGATCTTCGTGGTCGTCGCCCACAAGAACAGCCCGCACTACGAGCGACTGAAGAAGTCGGCCGACTGCC
GCTTCGGCATCTTGTCACAGGTGGTCAACGGCGATCACGTCAAGAAGAACAACGGCCAGTACCTGTCCAACGTGG
CCATGAAGGTCAACGCCAAGCTCGGCGGCGCCACGTCGCGCACGATGCCCCCCTGGAAGAGCCAGACCTTCTTCC
CCAAGGACCGACCGACCATGATGATTGGCGTCGACGTTTCGCATGGCGCTCCGGGTAGCAACGCGCCGTCGACGG
CGGCCATGACCATGTCGGTTGACCGCGACGCGACTCGATACGCCGCCATGGTCGAGACCAACGGCTTCCGCGTCG
AGATTCTCACGGCGGCCAACGTTCATTTCCTATTTGGACAGCTCGCCGATGAGTGGAAAAAGGGCCACGAAGGCG
CCTTTCCCAAGCACATTGTCTACTTCCGAGATGGCGTCTCCGAGGGACAGTTTTCGCAAGTGATCGACCAAGAAA
TCTCTGAGATTCGCTGCTTCTTCCGGTCTAAGGCGCCCCAGATGCCGATGCCCAAGTTCACCGTTGTGGTGGCCA
CCAAGCGCCACCATATCCGCTTCTTCCCCGGCCAGGGCGACAAGAACGGCAACGCGCTTCCGGGTACTCTCGTTG
AGAAAGAGGTCACACATCCCTTCATGTGGGACTTTTACATGTGCTCCCACGTCGCCATCCAGGGCACCGCACGCC
CCGTCCATTACCACGTCATCCTGGATGAGATGAACGTGCCGGTCAATGACTTTCAGAAGATGATCTATCATCAGT
GCTACAGTTACGCCAGATCGACGACGCCCGTGTCGCTGCATCCGGCCGTCTACTACGCACATCTGGCTGGAGCGC
GGGCCCGGGCTCACGAGAACATCGCCACGTCGGAGGGCTTCCGATCCGGAGCCAAGGGTCACGAGATGATCCGCG
ACCAGGTCGCCAAGGGGGCCACCATCGGCAGTATCCCCAGCGGCACCGAGTCGCCTGCCCTTTTGACGCTGGGCG
GAAGAGTCAACCCGGACAAGGGCCCGGACCCAGGCGAGCAGCGACAGCGGGACTTCTTCCGCAGTACCATGTGGT
ACATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail