Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|430
Gene name
LocationContig_112:12855..13755
Strand+
Gene length (bp)900
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04263 TPK_catalytic Thiamin pyrophosphokinase, catalytic domain 9.9E-30 39 147
PF04265 TPK_B1_binding Thiamin pyrophosphokinase, vitamin B1 binding domain 1.6E-22 176 247

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0JMW0|TPK2_ORYSJ Thiamine pyrophosphokinase 2 OS=Oryza sativa subsp. japonica GN=TPK2 PE=2 SV=1 22 255 1.0E-33
sp|B9DGU7|TPK1_ARATH Thiamine pyrophosphokinase 1 OS=Arabidopsis thaliana GN=TPK1 PE=2 SV=1 16 254 6.0E-33
sp|Q9H3S4|TPK1_HUMAN Thiamin pyrophosphokinase 1 OS=Homo sapiens GN=TPK1 PE=1 SV=1 22 253 8.0E-33
sp|Q60DX1|TPK3_ORYSJ Thiamine pyrophosphokinase 3 OS=Oryza sativa subsp. japonica GN=TPK3 PE=2 SV=1 25 253 2.0E-32
sp|F4IV16|TPK2_ARATH Thiamine pyrophosphokinase 2 OS=Arabidopsis thaliana GN=TPK2 PE=2 SV=1 16 254 8.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0JMW0|TPK2_ORYSJ Thiamine pyrophosphokinase 2 OS=Oryza sativa subsp. japonica GN=TPK2 PE=2 SV=1 22 255 1.0E-33
sp|B9DGU7|TPK1_ARATH Thiamine pyrophosphokinase 1 OS=Arabidopsis thaliana GN=TPK1 PE=2 SV=1 16 254 6.0E-33
sp|Q9H3S4|TPK1_HUMAN Thiamin pyrophosphokinase 1 OS=Homo sapiens GN=TPK1 PE=1 SV=1 22 253 8.0E-33
sp|Q60DX1|TPK3_ORYSJ Thiamine pyrophosphokinase 3 OS=Oryza sativa subsp. japonica GN=TPK3 PE=2 SV=1 25 253 2.0E-32
sp|F4IV16|TPK2_ARATH Thiamine pyrophosphokinase 2 OS=Arabidopsis thaliana GN=TPK2 PE=2 SV=1 16 254 8.0E-32
sp|Q5JK24|TPK1_ORYSJ Thiamine pyrophosphokinase 1 OS=Oryza sativa subsp. japonica GN=TPK1 PE=2 SV=1 18 253 6.0E-31
sp|Q5E9T4|TPK1_BOVIN Thiamin pyrophosphokinase 1 OS=Bos taurus GN=TPK1 PE=2 SV=1 20 253 2.0E-29
sp|Q9R0M5|TPK1_MOUSE Thiamin pyrophosphokinase 1 OS=Mus musculus GN=Tpk1 PE=1 SV=1 22 253 2.0E-29
sp|P41888|TNR3_SCHPO Thiamine pyrophosphokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tnr3 PE=3 SV=1 5 241 1.0E-24
sp|P35202|THI80_YEAST Thiamine pyrophosphokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI80 PE=1 SV=1 24 252 2.0E-20
sp|P30636|TPK1_CAEEL Thiamin pyrophosphokinase 1 OS=Caenorhabditis elegans GN=tpk-1 PE=1 SV=3 30 253 1.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0009229 thiamine diphosphate biosynthetic process Yes
GO:0030975 thiamine binding Yes
GO:0004788 thiamine diphosphokinase activity Yes
GO:0042357 thiamine diphosphate metabolic process No
GO:0016740 transferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0042724 thiamine-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:1901681 sulfur compound binding No
GO:0019842 vitamin binding No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0043178 alcohol binding No
GO:0090407 organophosphate biosynthetic process No
GO:0008152 metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0044272 sulfur compound biosynthetic process No
GO:0036094 small molecule binding No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016778 diphosphotransferase activity No
GO:0006790 sulfur compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0042723 thiamine-containing compound metabolic process No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006766 vitamin metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0030554 adenyl nucleotide binding No
GO:0006767 water-soluble vitamin metabolic process No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1874
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3625
Ophiocordyceps australis map64 (Brazil) OphauB2|130
Ophiocordyceps camponoti-floridani Ophcf2|00669
Ophiocordyceps camponoti-rufipedis Ophun1|430 (this protein)
Ophiocordyceps kimflemingae Ophio5|5439
Ophiocordyceps subramaniannii Hirsu2|1916

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|430
MTSRTFEWHPAKLLQEKECSPEFALLVLNQPLKNGNDLRRLWNNSSLRVAADGGANRLHDLSSFRGKFSNLQAIV
GDLDSLTPSVKNFYCSQPTPTQVIHNSDQESTDFGKAIAWIRQKHPKGLDIVALGGLGGRVDQGVSQLHQLYLSQ
PGPDYSDGRVYLLSGSSLTFLLKAGTHRIQVKEDGENVTFGKYVGIIPLQEPSIISTKGLRWDVCEWETKMGGQL
STSNHVLPEAKSVEVQTTKDVLFTIALRRIDGEDDG*
Coding >Ophun1|430
ATGACGTCGCGCACTTTTGAGTGGCACCCGGCCAAGCTGCTGCAGGAGAAAGAATGCAGCCCCGAATTCGCCCTT
CTGGTGCTGAACCAGCCGCTCAAGAACGGCAATGACTTGCGTCGCCTCTGGAATAACTCCTCTCTTCGGGTCGCC
GCCGACGGGGGCGCTAACCGCCTTCACGATCTATCCTCGTTCCGGGGCAAGTTTTCGAATCTGCAGGCCATAGTC
GGTGACCTCGACTCGTTGACGCCGTCTGTCAAAAACTTTTACTGCTCTCAGCCCACACCCACGCAGGTCATTCAC
AACTCCGACCAGGAATCGACCGACTTTGGGAAAGCCATTGCCTGGATCCGTCAAAAGCACCCCAAAGGTCTTGAC
ATCGTCGCCCTCGGAGGCCTCGGAGGCCGTGTCGACCAGGGCGTCAGCCAGCTCCACCAACTCTATCTTTCCCAG
CCCGGACCCGACTACTCTGATGGTCGCGTATACCTTTTGTCCGGCTCGAGCCTGACATTCCTCCTCAAAGCCGGA
ACGCATCGTATCCAGGTCAAGGAAGACGGCGAGAATGTCACATTCGGCAAATATGTCGGCATCATCCCGCTCCAG
GAGCCCAGTATCATCTCCACAAAGGGGCTCCGGTGGGACGTGTGTGAGTGGGAAACGAAGATGGGGGGCCAGCTC
AGCACCAGCAACCACGTCCTGCCCGAGGCCAAGTCGGTCGAGGTCCAGACCACAAAAGACGTACTCTTCACGATA
GCACTACGGCGCATCGACGGCGAGGACGACGGATAG
Transcript >Ophun1|430
ATGACGTCGCGCACTTTTGAGTGGCACCCGGCCAAGCTGCTGCAGGAGAAAGAATGCAGCCCCGAATTCGCCCTT
CTGGTGCTGAACCAGCCGCTCAAGAACGGCAATGACTTGCGTCGCCTCTGGAATAACTCCTCTCTTCGGGTCGCC
GCCGACGGGGGCGCTAACCGCCTTCACGATCTATCCTCGTTCCGGGGCAAGTTTTCGAATCTGCAGGCCATAGTC
GGTGACCTCGACTCGTTGACGCCGTCTGTCAAAAACTTTTACTGCTCTCAGCCCACACCCACGCAGGTCATTCAC
AACTCCGACCAGGAATCGACCGACTTTGGGAAAGCCATTGCCTGGATCCGTCAAAAGCACCCCAAAGGTCTTGAC
ATCGTCGCCCTCGGAGGCCTCGGAGGCCGTGTCGACCAGGGCGTCAGCCAGCTCCACCAACTCTATCTTTCCCAG
CCCGGACCCGACTACTCTGATGGTCGCGTATACCTTTTGTCCGGCTCGAGCCTGACATTCCTCCTCAAAGCCGGA
ACGCATCGTATCCAGGTCAAGGAAGACGGCGAGAATGTCACATTCGGCAAATATGTCGGCATCATCCCGCTCCAG
GAGCCCAGTATCATCTCCACAAAGGGGCTCCGGTGGGACGTGTGTGAGTGGGAAACGAAGATGGGGGGCCAGCTC
AGCACCAGCAACCACGTCCTGCCCGAGGCCAAGTCGGTCGAGGTCCAGACCACAAAAGACGTACTCTTCACGATA
GCACTACGGCGCATCGACGGCGAGGACGACGGATAG
Gene >Ophun1|430
ATGACGTCGCGCACTTTTGAGTGGCACCCGGCCAAGCTGCTGCAGGAGAAAGAATGCAGCCCCGAATTCGCCCTT
CTGGTGCTGAACCAGCCGCTCAAGAACGGCAATGACTTGCGTCGCCTCTGGAATAACTGTACGCTGCCTCATGAC
TCGCTTTTCGTGAAAAGTCATACGTGCAGGCTGACGAGTCGCTAAGCCTCTCTTCGGGTCGCCGCCGACGGGGGC
GCTAACCGCCTTCACGATCTATCCTCGTTCCGGGGCAAGTTTGTGAGATGAATCCCCTCGAGGACTCTGTTCTTA
TCCTCACCCGCGCGACAGTCGAATCTGCAGGCCATAGTCGGTGACCTCGACTCGTTGACGCCGTCTGTCAAAAAC
TTTTACTGCTCTCAGCCCACACCCACGCAGGTCATTCACAACTCCGACCAGGAATCGACCGACTTTGGGAAAGCC
ATTGCCTGGATCCGTCAAAAGCACCCCAAAGGTCTTGACATCGTCGCCCTCGGAGGCCTCGGAGGCCGTGTCGAC
CAGGGCGTCAGCCAGCTCCACCAACTCTATCTTTCCCAGCCCGGACCCGACTACTCTGATGGTCGCGTATACCTT
TTGTCCGGCTCGAGCCTGACATTCCTCCTCAAAGCCGGAACGCATCGTATCCAGGTCAAGGAAGACGGCGAGAAT
GTCACATTCGGCAAATATGTCGGCATCATCCCGCTCCAGGAGCCCAGTATCATCTCCACAAAGGGGCTCCGGTGG
GACGTGTGTGAGTGGGAAACGAAGATGGGGGGCCAGCTCAGCACCAGCAACCACGTCCTGCCCGAGGCCAAGTCG
GTCGAGGTCCAGACCACAAAAGACGTACTCTTCACGATAGCACTACGGCGCATCGACGGCGAGGACGACGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail