Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4281
Gene name
LocationContig_395:14420..16222
Strand-
Gene length (bp)1802
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20143 NAD_kinase_C ATP-NAD kinase C-terminal domain 2.8E-27 426 545
PF01513 NAD_kinase ATP-NAD kinase N-terminal domain 7.7E-25 197 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21373|UTR1_YEAST NAD(+) kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR1 PE=1 SV=2 162 573 2.0E-88
sp|Q6LA56|YF4B_SCHPO Uncharacterized kinase C3H5.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.11 PE=3 SV=1 150 565 4.0E-84
sp|O13863|YDU2_SCHPO Uncharacterized kinase C1B1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B1.02c PE=1 SV=1 163 574 4.0E-84
sp|P32622|YEF1_YEAST ATP-NADH kinase YEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF1 PE=1 SV=1 128 573 9.0E-80
sp|Q9P7K3|YJN2_SCHPO Uncharacterized kinase C24B10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.02c PE=1 SV=1 191 573 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21373|UTR1_YEAST NAD(+) kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR1 PE=1 SV=2 162 573 2.0E-88
sp|Q6LA56|YF4B_SCHPO Uncharacterized kinase C3H5.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.11 PE=3 SV=1 150 565 4.0E-84
sp|O13863|YDU2_SCHPO Uncharacterized kinase C1B1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B1.02c PE=1 SV=1 163 574 4.0E-84
sp|P32622|YEF1_YEAST ATP-NADH kinase YEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF1 PE=1 SV=1 128 573 9.0E-80
sp|Q9P7K3|YJN2_SCHPO Uncharacterized kinase C24B10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.02c PE=1 SV=1 191 573 2.0E-55
sp|O95544|NADK_HUMAN NAD kinase OS=Homo sapiens GN=NADK PE=1 SV=1 190 573 5.0E-55
sp|P58058|NADK_MOUSE NAD kinase OS=Mus musculus GN=Nadk PE=1 SV=2 191 575 2.0E-54
sp|Q53NI2|NADK2_ORYSJ Probable NAD kinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0191400 PE=2 SV=1 280 572 4.0E-54
sp|Q5JK52|NADK1_ORYSJ Probable NAD kinase 1 OS=Oryza sativa subsp. japonica GN=Os01g0957000 PE=2 SV=1 264 570 1.0E-53
sp|Q9C5W3|NADK2_ARATH NAD kinase 2, chloroplastic OS=Arabidopsis thaliana GN=NADK2 PE=1 SV=1 280 572 3.0E-53
sp|Q56YN3|NADK1_ARATH NAD(H) kinase 1 OS=Arabidopsis thaliana GN=NADK1 PE=1 SV=2 191 570 3.0E-53
sp|Q60E60|NADK3_ORYSJ Putative NAD kinase 3 OS=Oryza sativa subsp. japonica GN=Os05g0388400 PE=3 SV=2 280 570 6.0E-52
sp|Q9UT98|POS5_SCHPO NADH kinase pos5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pos5 PE=3 SV=2 242 573 1.0E-34
sp|B5EFY8|NADK_GEOBB NAD kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=nadK PE=3 SV=1 280 567 2.0E-27
sp|Q06892|POS5_YEAST NADH kinase POS5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POS5 PE=1 SV=2 274 566 2.0E-27
sp|B3E6Y9|NADK_GEOLS NAD kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=nadK PE=3 SV=1 189 567 2.0E-26
sp|C6E6I5|NADK_GEOSM NAD kinase OS=Geobacter sp. (strain M21) GN=nadK PE=3 SV=1 280 567 2.0E-26
sp|Q6MII5|NADK_BDEBA NAD kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nadK PE=3 SV=1 272 539 5.0E-25
sp|Q39X41|NADK_GEOMG NAD kinase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nadK PE=3 SV=1 276 567 1.0E-24
sp|B3EPT7|NADK_CHLPB NAD kinase OS=Chlorobium phaeobacteroides (strain BS1) GN=nadK PE=3 SV=1 194 569 3.0E-24
sp|Q74BH6|NADK_GEOSL NAD kinase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nadK PE=3 SV=1 276 567 4.0E-24
sp|B9M5P5|NADK_GEODF NAD kinase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=nadK PE=3 SV=1 276 567 2.0E-23
sp|Q2RIC1|NADK_MOOTA NAD kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=nadK PE=3 SV=1 282 540 2.0E-23
sp|B8FN99|NADK_DESAA NAD kinase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=nadK PE=3 SV=1 276 565 3.0E-23
sp|A4SGU4|NADK_CHLPM NAD kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=nadK PE=3 SV=1 191 565 1.0E-22
sp|A8ZWQ4|NADK_DESOH NAD kinase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=nadK PE=3 SV=1 273 565 2.0E-22
sp|A1BJI4|NADK_CHLPD NAD kinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=nadK PE=3 SV=1 280 565 4.0E-22
sp|B3EI21|NADK_CHLL2 NAD kinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=nadK PE=3 SV=1 278 565 5.0E-22
sp|Q3A241|NADK_PELCD NAD kinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=nadK PE=3 SV=1 192 567 6.0E-22
sp|C1F1S2|NADK_ACIC5 NAD kinase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=nadK PE=3 SV=1 280 567 2.0E-21
sp|C1DPY6|NADK_AZOVD NAD kinase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=nadK PE=3 SV=1 280 567 2.0E-21
sp|Q02A16|NADK_SOLUE NAD kinase OS=Solibacter usitatus (strain Ellin6076) GN=nadK PE=3 SV=1 276 521 3.0E-21
sp|A0LG64|NADK_SYNFM NAD kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nadK PE=3 SV=1 276 565 6.0E-21
sp|Q8RAC3|NADK_CALS4 NAD kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=nadK PE=3 SV=1 258 501 6.0E-21
sp|A5D2Z8|NADK_PELTS NAD kinase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=nadK PE=3 SV=1 282 572 8.0E-21
sp|Q8KG83|NADK_CHLTE NAD kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=nadK PE=3 SV=1 280 565 2.0E-20
sp|B0K0V4|NADK_THEPX NAD kinase OS=Thermoanaerobacter sp. (strain X514) GN=nadK PE=3 SV=1 280 501 2.0E-20
sp|B0K9E7|NADK_THEP3 NAD kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=nadK PE=3 SV=1 280 501 2.0E-20
sp|B0TEJ8|NADK_HELMI NAD kinase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=nadK PE=3 SV=1 272 534 2.0E-20
sp|B3QLE4|NADK_CHLP8 NAD kinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=nadK PE=3 SV=1 280 565 2.0E-20
sp|B4S665|NADK_PROA2 NAD kinase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=nadK PE=3 SV=1 194 572 2.0E-20
sp|B4SGW9|NADK_PELPB NAD kinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=nadK PE=3 SV=1 280 564 3.0E-20
sp|B1J554|NADK_PSEPW NAD kinase OS=Pseudomonas putida (strain W619) GN=nadK PE=3 SV=1 280 567 6.0E-20
sp|B8I3A3|NADK_CLOCE NAD kinase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=nadK PE=3 SV=1 280 537 2.0E-19
sp|Q1ISV1|NADK_KORVE NAD kinase OS=Koribacter versatilis (strain Ellin345) GN=nadK PE=3 SV=1 280 568 2.0E-19
sp|Q6AL12|NADK_DESPS NAD kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=nadK PE=3 SV=1 277 570 2.0E-19
sp|C4L8Y7|NADK_TOLAT NAD kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=nadK PE=3 SV=1 280 567 2.0E-19
sp|Q3B189|NADK_CHLL7 NAD kinase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=nadK PE=3 SV=1 280 572 2.0E-19
sp|Q6MDK7|NADK_PARUW NAD kinase OS=Protochlamydia amoebophila (strain UWE25) GN=nadK PE=3 SV=1 279 569 2.0E-19
sp|Q9HZC0|NADK_PSEAE NAD kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nadK PE=3 SV=1 278 567 2.0E-19
sp|Q02PQ1|NADK_PSEAB NAD kinase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nadK PE=3 SV=1 278 567 2.0E-19
sp|B7UUY3|NADK_PSEA8 NAD kinase OS=Pseudomonas aeruginosa (strain LESB58) GN=nadK PE=3 SV=1 278 567 2.0E-19
sp|A6V2Y8|NADK_PSEA7 NAD kinase OS=Pseudomonas aeruginosa (strain PA7) GN=nadK PE=3 SV=1 278 567 2.0E-19
sp|Q8DF58|NADK_VIBVU NAD kinase OS=Vibrio vulnificus (strain CMCP6) GN=nadK PE=3 SV=1 190 567 3.0E-19
sp|B0KFA9|NADK_PSEPG NAD kinase OS=Pseudomonas putida (strain GB-1) GN=nadK PE=3 SV=1 280 567 3.0E-19
sp|A3DDM2|NADK_CLOTH NAD kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=nadK PE=3 SV=1 216 562 3.0E-19
sp|A0L8H9|NADK_MAGMM NAD kinase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nadK PE=3 SV=1 189 564 4.0E-19
sp|Q88LC3|NADK_PSEPK NAD kinase OS=Pseudomonas putida (strain KT2440) GN=nadK PE=3 SV=2 280 567 4.0E-19
sp|A5W6U4|NADK_PSEP1 NAD kinase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nadK PE=3 SV=1 280 567 4.0E-19
sp|B0TQ38|NADK_SHEHH NAD kinase OS=Shewanella halifaxensis (strain HAW-EB4) GN=nadK PE=3 SV=1 280 567 4.0E-19
sp|Q1ICQ6|NADK_PSEE4 NAD kinase OS=Pseudomonas entomophila (strain L48) GN=nadK PE=3 SV=1 280 567 4.0E-19
sp|Q7MN93|NADK_VIBVY NAD kinase OS=Vibrio vulnificus (strain YJ016) GN=nadK PE=3 SV=1 190 567 5.0E-19
sp|C3KXC0|NADK_CLOB6 NAD kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=nadK PE=3 SV=1 252 568 1.0E-18
sp|A6VXA6|NADK_MARMS NAD kinase OS=Marinomonas sp. (strain MWYL1) GN=nadK PE=3 SV=1 280 566 2.0E-18
sp|C1FPA6|NADK_CLOBJ NAD kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=nadK PE=3 SV=1 252 568 2.0E-18
sp|Q1QXZ6|NADK_CHRSD NAD kinase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=nadK PE=3 SV=1 273 567 2.0E-18
sp|B1KT47|NADK_CLOBM NAD kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=nadK PE=3 SV=1 252 568 2.0E-18
sp|Q4KBJ2|NADK_PSEF5 NAD kinase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nadK PE=3 SV=1 280 535 2.0E-18
sp|Q7V3C2|NADK1_PROMP NAD kinase 1 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=nadK1 PE=3 SV=1 280 564 2.0E-18
sp|Q3KE68|NADK_PSEPF NAD kinase OS=Pseudomonas fluorescens (strain Pf0-1) GN=nadK PE=3 SV=1 280 535 2.0E-18
sp|O67055|NADK_AQUAE NAD kinase OS=Aquifex aeolicus (strain VF5) GN=nadK PE=3 SV=1 435 539 3.0E-18
sp|A7GEJ1|NADK_CLOBL NAD kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=nadK PE=3 SV=1 252 568 4.0E-18
sp|B1IMN2|NADK_CLOBK NAD kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=nadK PE=3 SV=1 252 568 4.0E-18
sp|A7FUT5|NADK_CLOB1 NAD kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=nadK PE=3 SV=1 252 568 4.0E-18
sp|Q67NC1|NADK_SYMTH NAD kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nadK PE=3 SV=1 279 555 4.0E-18
sp|A7MWW3|NADK_VIBCB NAD kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=nadK PE=3 SV=1 190 567 5.0E-18
sp|C3K9T0|NADK_PSEFS NAD kinase OS=Pseudomonas fluorescens (strain SBW25) GN=nadK PE=3 SV=1 280 535 6.0E-18
sp|A4XWI3|NADK_PSEMY NAD kinase OS=Pseudomonas mendocina (strain ymp) GN=nadK PE=3 SV=1 280 567 8.0E-18
sp|Q3ANS5|NADK_CHLCH NAD kinase OS=Chlorobium chlorochromatii (strain CaD3) GN=nadK PE=3 SV=1 280 565 9.0E-18
sp|Q4ZVT9|NADK_PSEU2 NAD kinase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nadK PE=3 SV=1 280 535 1.0E-17
sp|Q87RX6|NADK_VIBPA NAD kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nadK PE=3 SV=1 190 567 1.0E-17
sp|Q47HJ4|NADK_DECAR NAD kinase OS=Dechloromonas aromatica (strain RCB) GN=nadK PE=3 SV=1 280 569 1.0E-17
sp|Q87YK2|NADK_PSESM NAD kinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nadK PE=3 SV=1 280 535 1.0E-17
sp|Q48FT7|NADK_PSE14 NAD kinase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nadK PE=3 SV=1 280 535 1.0E-17
sp|Q12DZ0|NADK_POLSJ NAD kinase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nadK PE=3 SV=1 280 565 1.0E-17
sp|Q83C38|NADK_COXBU NAD kinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nadK PE=3 SV=1 280 570 2.0E-17
sp|A9KG94|NADK_COXBN NAD kinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nadK PE=3 SV=1 280 570 2.0E-17
sp|B6IZI4|NADK_COXB2 NAD kinase OS=Coxiella burnetii (strain CbuG_Q212) GN=nadK PE=3 SV=1 280 570 2.0E-17
sp|B6J7V3|NADK_COXB1 NAD kinase OS=Coxiella burnetii (strain CbuK_Q154) GN=nadK PE=3 SV=1 280 570 2.0E-17
sp|Q12L24|NADK_SHEDO NAD kinase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=nadK PE=3 SV=1 280 567 2.0E-17
sp|Q5E3A4|NADK_VIBF1 NAD kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=nadK PE=3 SV=1 280 567 2.0E-17
sp|Q9PHM6|NADK_CAMJE NAD kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nadK PE=3 SV=1 280 564 2.0E-17
sp|A4J3G3|NADK_DESRM NAD kinase OS=Desulfotomaculum reducens (strain MI-1) GN=nadK PE=3 SV=1 280 558 3.0E-17
sp|B1KQZ0|NADK_SHEWM NAD kinase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nadK PE=3 SV=1 280 567 3.0E-17
sp|B8CS28|NADK_SHEPW NAD kinase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=nadK PE=3 SV=1 280 567 4.0E-17
sp|A3QGP1|NADK_SHELP NAD kinase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=nadK PE=3 SV=1 280 567 4.0E-17
sp|Q07ZD2|NADK_SHEFN NAD kinase OS=Shewanella frigidimarina (strain NCIMB 400) GN=nadK PE=3 SV=1 280 567 5.0E-17
sp|O26958|NADK_METTH NAD kinase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=nadK PE=3 SV=1 280 562 5.0E-17
sp|Q3SHA5|NADK_THIDA NAD kinase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nadK PE=3 SV=1 280 567 7.0E-17
sp|Q97HD7|NADK_CLOAB NAD kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nadK PE=3 SV=1 263 539 8.0E-17
sp|C4Z0G9|NADK_EUBE2 NAD kinase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=nadK PE=3 SV=1 273 537 8.0E-17
sp|A8FL62|NADK_CAMJ8 NAD kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nadK PE=3 SV=1 280 564 1.0E-16
sp|Q5HVD0|NADK_CAMJR NAD kinase OS=Campylobacter jejuni (strain RM1221) GN=nadK PE=3 SV=1 280 564 1.0E-16
sp|A1VZ01|NADK_CAMJJ NAD kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nadK PE=3 SV=1 280 564 1.0E-16
sp|Q0AHZ4|NADK_NITEC NAD kinase OS=Nitrosomonas eutropha (strain C91) GN=nadK PE=3 SV=1 280 528 1.0E-16
sp|B7VJW6|NADK_VIBTL NAD kinase OS=Vibrio tasmaniensis (strain LGP32) GN=nadK PE=3 SV=1 183 567 1.0E-16
sp|P74430|NADK1_SYNY3 NAD kinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadK1 PE=3 SV=1 268 571 1.0E-16
sp|A1U2D4|NADK_MARHV NAD kinase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=nadK PE=3 SV=1 280 564 2.0E-16
sp|C5BL09|NADK_TERTT NAD kinase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=nadK PE=3 SV=1 274 564 2.0E-16
sp|A5FJ93|NADK_FLAJ1 NAD kinase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=nadK PE=3 SV=1 279 504 2.0E-16
sp|A9KMB6|NADK_CLOPH NAD kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=nadK PE=3 SV=1 276 548 2.0E-16
sp|Q2SDI1|NADK_HAHCH NAD kinase OS=Hahella chejuensis (strain KCTC 2396) GN=nadK PE=3 SV=1 278 572 2.0E-16
sp|A9N8H8|NADK_COXBR NAD kinase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nadK PE=3 SV=1 280 570 2.0E-16
sp|Q3AAN2|NADK_CARHZ NAD kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nadK PE=3 SV=1 437 549 2.0E-16
sp|Q6FA87|NADK_ACIAD NAD kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=nadK PE=3 SV=1 278 565 2.0E-16
sp|A1VKP7|NADK_POLNA NAD kinase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nadK PE=3 SV=1 280 565 2.0E-16
sp|B9KFZ4|NADK_CAMLR NAD kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=nadK PE=3 SV=1 432 564 2.0E-16
sp|C3LTA3|NADK_VIBCM NAD kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nadK PE=3 SV=1 190 567 3.0E-16
sp|Q9KTP8|NADK_VIBCH NAD kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nadK PE=3 SV=1 190 567 3.0E-16
sp|A5F368|NADK_VIBC3 NAD kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nadK PE=3 SV=1 190 567 3.0E-16
sp|A0LXV8|NADK_GRAFK NAD kinase OS=Gramella forsetii (strain KT0803) GN=nadK PE=3 SV=1 279 564 5.0E-16
sp|Q5WSY8|NADK_LEGPL NAD kinase OS=Legionella pneumophila (strain Lens) GN=nadK PE=3 SV=1 280 569 5.0E-16
sp|Q8YN19|NADK1_NOSS1 NAD kinase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nadK1 PE=3 SV=1 279 571 5.0E-16
sp|A5IHZ7|NADK_LEGPC NAD kinase OS=Legionella pneumophila (strain Corby) GN=nadK PE=3 SV=1 280 569 6.0E-16
sp|Q5ZRQ7|NADK_LEGPH NAD kinase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nadK PE=3 SV=1 280 569 6.0E-16
sp|Q5X168|NADK_LEGPA NAD kinase OS=Legionella pneumophila (strain Paris) GN=nadK PE=3 SV=1 280 569 6.0E-16
sp|Q9S219|NADK2_STRCO NAD kinase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nadK2 PE=3 SV=1 269 541 7.0E-16
sp|Q73MB8|NADK_TREDE NAD kinase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=nadK PE=3 SV=1 279 571 7.0E-16
sp|Q21XX2|NADK_RHOFT NAD kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nadK PE=3 SV=1 280 565 9.0E-16
sp|B2A524|NADK_NATTJ NAD kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=nadK PE=3 SV=1 280 556 1.0E-15
sp|Q7NVM0|NADK_CHRVO NAD kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nadK PE=3 SV=1 280 567 1.0E-15
sp|B9LAP2|NADK_CHLSY NAD kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=nadK PE=3 SV=1 273 537 1.0E-15
sp|A9WIJ8|NADK_CHLAA NAD kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=nadK PE=3 SV=1 273 537 1.0E-15
sp|Q8XJE3|NADK_CLOPE NAD kinase OS=Clostridium perfringens (strain 13 / Type A) GN=nadK PE=3 SV=1 279 549 2.0E-15
sp|C1D6U5|NADK_LARHH NAD kinase OS=Laribacter hongkongensis (strain HLHK9) GN=nadK PE=3 SV=1 278 567 2.0E-15
sp|Q0TPE0|NADK_CLOP1 NAD kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=nadK PE=3 SV=1 279 549 2.0E-15
sp|A7H4H1|NADK_CAMJD NAD kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nadK PE=3 SV=1 280 564 2.0E-15
sp|Q3MBU3|NADK1_ANAVT NAD kinase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nadK1 PE=3 SV=2 279 571 2.0E-15
sp|A2SL48|NADK_METPP NAD kinase OS=Methylibium petroleiphilum (strain PM1) GN=nadK PE=3 SV=1 280 565 2.0E-15
sp|Q0SS07|NADK_CLOPS NAD kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=nadK PE=3 SV=1 279 549 3.0E-15
sp|A1K8P2|NADK_AZOSB NAD kinase OS=Azoarcus sp. (strain BH72) GN=nadK PE=3 SV=1 280 566 3.0E-15
sp|Q5N133|NADK1_SYNP6 NAD kinase 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=nadK1 PE=3 SV=1 276 571 4.0E-15
sp|Q6LX63|NPPNK_METMP Bifunctional NADP phosphatase/NAD kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1489 PE=3 SV=1 282 537 4.0E-15
sp|Q7NFK0|NADK2_GLOVI NAD kinase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=nadK2 PE=3 SV=1 267 571 4.0E-15
sp|Q0VQV5|NADK_ALCBS NAD kinase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=nadK PE=3 SV=1 280 567 6.0E-15
sp|A6H1D1|NADK_FLAPJ NAD kinase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=nadK PE=3 SV=1 279 564 6.0E-15
sp|Q5P1G9|NADK_AROAE NAD kinase OS=Aromatoleum aromaticum (strain EbN1) GN=nadK PE=3 SV=1 280 537 9.0E-15
sp|A5N7J4|NADK_CLOK5 NAD kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=nadK PE=3 SV=1 279 572 9.0E-15
sp|B9E106|NADK_CLOK1 NAD kinase OS=Clostridium kluyveri (strain NBRC 12016) GN=nadK PE=3 SV=1 279 572 9.0E-15
sp|A1WGS0|NADK_VEREI NAD kinase OS=Verminephrobacter eiseniae (strain EF01-2) GN=nadK PE=3 SV=1 280 565 9.0E-15
sp|A4SQ27|NADK_AERS4 NAD kinase OS=Aeromonas salmonicida (strain A449) GN=nadK PE=3 SV=1 280 567 1.0E-14
sp|Q30RL8|NADK_SULDN NAD kinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nadK PE=3 SV=1 427 564 1.0E-14
sp|A9BP04|NADK_DELAS NAD kinase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=nadK PE=3 SV=1 280 565 1.0E-14
sp|Q5QXM6|NADK_IDILO NAD kinase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=nadK PE=3 SV=1 280 567 1.0E-14
sp|Q7MR67|NADK_WOLSU NAD kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nadK PE=3 SV=1 441 565 1.0E-14
sp|C5CYY6|NADK_VARPS NAD kinase OS=Variovorax paradoxus (strain S110) GN=nadK PE=3 SV=1 280 565 1.0E-14
sp|B3QYG7|NADK_CHLT3 NAD kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nadK PE=3 SV=1 280 569 2.0E-14
sp|B8G9X9|NADK_CHLAD NAD kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=nadK PE=3 SV=1 273 537 2.0E-14
sp|Q31D25|NADK1_PROM9 NAD kinase 1 OS=Prochlorococcus marinus (strain MIT 9312) GN=nadK1 PE=3 SV=1 280 564 2.0E-14
sp|Q82UK6|NADK_NITEU NAD kinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nadK PE=3 SV=1 280 528 2.0E-14
sp|A9BHU3|NADK_PETMO NAD kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=nadK PE=3 SV=1 441 567 2.0E-14
sp|Q65UL1|NADK_MANSM NAD kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=nadK PE=3 SV=2 281 564 2.0E-14
sp|Q6LUA9|NADK_PHOPR NAD kinase OS=Photobacterium profundum GN=nadK PE=3 SV=1 280 567 3.0E-14
sp|B9MRX9|NADK_CALBD NAD kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=nadK PE=3 SV=1 279 549 3.0E-14
sp|Q66DA9|NADK_YERPS NAD kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nadK PE=3 SV=1 280 567 3.0E-14
sp|A7MHX2|NADK_CROS8 NAD kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nadK PE=3 SV=1 280 567 3.0E-14
sp|Q7W513|NADK_BORPA NAD kinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nadK PE=3 SV=1 370 565 3.0E-14
sp|Q7WGH8|NADK_BORBR NAD kinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nadK PE=3 SV=1 370 565 3.0E-14
sp|A1TT64|NADK_ACIAC NAD kinase OS=Acidovorax citrulli (strain AAC00-1) GN=nadK PE=3 SV=1 280 565 3.0E-14
sp|Q7VGM5|NADK_HELHP NAD kinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nadK PE=3 SV=1 280 536 4.0E-14
sp|Q7VVX6|NADK_BORPE NAD kinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nadK PE=3 SV=1 370 565 5.0E-14
sp|Q6D8Y0|NADK_PECAS NAD kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nadK PE=3 SV=1 280 567 5.0E-14
sp|A4IWQ8|NADK_FRATW NAD kinase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nadK PE=3 SV=1 280 565 5.0E-14
sp|Q4JVX8|NADK_CORJK NAD kinase OS=Corynebacterium jeikeium (strain K411) GN=nadK PE=3 SV=1 279 534 5.0E-14
sp|Q5NF19|NADK_FRATT NAD kinase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nadK PE=3 SV=1 280 565 6.0E-14
sp|Q14GH2|NADK_FRAT1 NAD kinase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nadK PE=3 SV=1 280 565 6.0E-14
sp|Q8DKK1|NADK1_THEEB NAD kinase 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=nadK1 PE=3 SV=1 281 571 6.0E-14
sp|Q6AGG7|NADK_LEIXX NAD kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=nadK PE=3 SV=1 276 541 7.0E-14
sp|Q8ZH09|NADK_YERPE NAD kinase OS=Yersinia pestis GN=nadK PE=1 SV=1 280 567 8.0E-14
sp|Q7VAW0|NADK2_PROMA NAD kinase 2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=nadK2 PE=3 SV=1 276 574 8.0E-14
sp|B2V4R1|NADK_CLOBA NAD kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=nadK PE=3 SV=1 283 568 9.0E-14
sp|B2TRM3|NADK_CLOBB NAD kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=nadK PE=3 SV=1 283 568 9.0E-14
sp|Q7UWB8|NADK_RHOBA NAD kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=nadK PE=3 SV=1 280 567 9.0E-14
sp|Q319M2|NADK2_PROM9 NAD kinase 2 OS=Prochlorococcus marinus (strain MIT 9312) GN=nadK2 PE=3 SV=1 279 574 1.0E-13
sp|Q7U406|NADK2_SYNPX NAD kinase 2 OS=Synechococcus sp. (strain WH8102) GN=nadK2 PE=3 SV=1 270 564 1.0E-13
sp|Q2KW92|NADK_BORA1 NAD kinase OS=Bordetella avium (strain 197N) GN=nadK PE=3 SV=1 281 565 1.0E-13
sp|A1W4H1|NADK_ACISJ NAD kinase OS=Acidovorax sp. (strain JS42) GN=nadK PE=3 SV=1 280 564 1.0E-13
sp|A6LU50|NADK_CLOB8 NAD kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=nadK PE=3 SV=1 279 526 1.0E-13
sp|A9KTL1|NADK_SHEB9 NAD kinase OS=Shewanella baltica (strain OS195) GN=nadK PE=3 SV=1 432 567 1.0E-13
sp|A6WL02|NADK_SHEB8 NAD kinase OS=Shewanella baltica (strain OS185) GN=nadK PE=3 SV=1 432 567 1.0E-13
sp|A1RLV5|NADK_SHESW NAD kinase OS=Shewanella sp. (strain W3-18-1) GN=nadK PE=3 SV=1 436 567 2.0E-13
sp|A4Y4W8|NADK_SHEPC NAD kinase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=nadK PE=3 SV=1 436 567 2.0E-13
sp|A3D2B0|NADK_SHEB5 NAD kinase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=nadK PE=3 SV=1 432 567 2.0E-13
sp|C1A482|NADK_GEMAT NAD kinase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=nadK PE=3 SV=1 279 572 2.0E-13
sp|Q7VE34|NADK1_PROMA NAD kinase 1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=nadK1 PE=3 SV=1 281 564 2.0E-13
sp|B2SDS9|NADK_FRATM NAD kinase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nadK PE=3 SV=1 280 565 2.0E-13
sp|Q473L9|NADK_CUPPJ NAD kinase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nadK PE=3 SV=2 280 565 2.0E-13
sp|Q7U5U5|NADK1_SYNPX NAD kinase 1 OS=Synechococcus sp. (strain WH8102) GN=nadK1 PE=3 SV=1 281 571 2.0E-13
sp|Q7V8H9|NADK1_PROMM NAD kinase 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=nadK1 PE=3 SV=1 276 571 2.0E-13
sp|C4K708|NADK_HAMD5 NAD kinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=nadK PE=3 SV=1 188 567 3.0E-13
sp|B9ME57|NADK_ACIET NAD kinase OS=Acidovorax ebreus (strain TPSY) GN=nadK PE=3 SV=1 280 564 3.0E-13
sp|Q8EGS1|NADK_SHEON NAD kinase OS=Shewanella oneidensis (strain MR-1) GN=nadK PE=3 SV=2 432 567 3.0E-13
sp|Q0BMU7|NADK_FRATO NAD kinase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nadK PE=3 SV=1 280 565 3.0E-13
sp|Q2A4H0|NADK_FRATH NAD kinase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nadK PE=3 SV=1 280 565 3.0E-13
sp|A7NAY2|NADK_FRATF NAD kinase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nadK PE=3 SV=1 280 565 3.0E-13
sp|A0Q7Q7|NADK_FRATN NAD kinase OS=Francisella tularensis subsp. novicida (strain U112) GN=nadK PE=3 SV=1 280 565 4.0E-13
sp|Q57L24|NADK_SALCH NAD kinase OS=Salmonella choleraesuis (strain SC-B67) GN=nadK PE=3 SV=2 280 567 4.0E-13
sp|Q0HGL3|NADK_SHESM NAD kinase OS=Shewanella sp. (strain MR-4) GN=nadK PE=3 SV=1 436 567 4.0E-13
sp|P65774|NADK_SALTY NAD kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nadK PE=1 SV=1 280 567 4.0E-13
sp|P65775|NADK_SALTI NAD kinase OS=Salmonella typhi GN=nadK PE=3 SV=1 280 567 4.0E-13
sp|B5BEA1|NADK_SALPK NAD kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=nadK PE=3 SV=1 280 567 4.0E-13
sp|Q5PFG7|NADK_SALPA NAD kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nadK PE=3 SV=1 280 567 4.0E-13
sp|B4T2C0|NADK_SALNS NAD kinase OS=Salmonella newport (strain SL254) GN=nadK PE=3 SV=1 280 567 4.0E-13
sp|B4TE58|NADK_SALHS NAD kinase OS=Salmonella heidelberg (strain SL476) GN=nadK PE=3 SV=1 280 567 4.0E-13
sp|B5F295|NADK_SALA4 NAD kinase OS=Salmonella agona (strain SL483) GN=nadK PE=3 SV=1 280 567 4.0E-13
sp|Q0HSW4|NADK_SHESR NAD kinase OS=Shewanella sp. (strain MR-7) GN=nadK PE=3 SV=1 436 567 5.0E-13
sp|B5RD91|NADK_SALG2 NAD kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nadK PE=3 SV=1 280 567 5.0E-13
sp|B5QUH0|NADK_SALEP NAD kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=nadK PE=3 SV=1 280 567 5.0E-13
sp|B5FS14|NADK_SALDC NAD kinase OS=Salmonella dublin (strain CT_02021853) GN=nadK PE=3 SV=1 280 567 5.0E-13
sp|A0KZB1|NADK_SHESA NAD kinase OS=Shewanella sp. (strain ANA-3) GN=nadK PE=3 SV=1 436 567 5.0E-13
sp|Q8NQM1|NADK_CORGL NAD kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=nadK PE=3 SV=1 280 575 5.0E-13
sp|B4TS62|NADK_SALSV NAD kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=nadK PE=3 SV=1 280 567 6.0E-13
sp|Q7N1U6|NADK_PHOLL NAD kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nadK PE=3 SV=1 280 567 6.0E-13
sp|Q51841|NADK_PORGI NAD kinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nadK PE=3 SV=2 276 527 8.0E-13
sp|Q7V0I8|NADK2_PROMP NAD kinase 2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=nadK2 PE=3 SV=1 279 565 9.0E-13
sp|A1KT64|NADK_NEIMF NAD kinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nadK PE=3 SV=1 280 541 9.0E-13
sp|P65773|NADK_NEIMB NAD kinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=nadK PE=3 SV=1 280 541 9.0E-13
sp|P65772|NADK_NEIMA NAD kinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nadK PE=3 SV=1 280 541 9.0E-13
sp|A9M3N9|NADK_NEIM0 NAD kinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=nadK PE=3 SV=1 280 541 9.0E-13
sp|A7GXF7|NADK_CAMC5 NAD kinase OS=Campylobacter curvus (strain 525.92) GN=nadK PE=3 SV=1 429 564 9.0E-13
sp|B2VEC5|NADK_ERWT9 NAD kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nadK PE=3 SV=1 280 567 1.0E-12
sp|C5BAK8|NADK_EDWI9 NAD kinase OS=Edwardsiella ictaluri (strain 93-146) GN=nadK PE=3 SV=1 280 567 1.0E-12
sp|Q32CX4|NADK_SHIDS NAD kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nadK PE=3 SV=1 278 567 2.0E-12
sp|C4ZCY4|NADK_EUBR3 NAD kinase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=nadK PE=3 SV=1 282 535 2.0E-12
sp|Q21JY6|NADK_SACD2 NAD kinase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=nadK PE=3 SV=1 280 564 2.0E-12
sp|Q5MZV1|NADK2_SYNP6 NAD kinase 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=nadK2 PE=3 SV=1 279 551 2.0E-12
sp|Q829B4|NADK2_STRAW NAD kinase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nadK2 PE=3 SV=1 280 541 2.0E-12
sp|Q17V60|NADK_HELAH NAD kinase OS=Helicobacter acinonychis (strain Sheeba) GN=nadK PE=3 SV=1 283 571 3.0E-12
sp|B7NSB3|NADK_ECO7I NAD kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nadK PE=3 SV=1 278 567 3.0E-12
sp|B2RIJ4|NADK_PORG3 NAD kinase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=nadK PE=3 SV=1 276 527 3.0E-12
sp|A4XKP6|NADK_CALS8 NAD kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=nadK PE=3 SV=1 280 537 3.0E-12
sp|A4WDH9|NADK_ENT38 NAD kinase OS=Enterobacter sp. (strain 638) GN=nadK PE=3 SV=1 280 567 3.0E-12
sp|Q11PL9|NADK_CYTH3 NAD kinase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=nadK PE=3 SV=1 424 564 3.0E-12
sp|Q31HB0|NADK_THICR NAD kinase OS=Thiomicrospira crunogena (strain XCL-2) GN=nadK PE=3 SV=1 279 567 3.0E-12
sp|Q8RGM4|NADK_FUSNN NAD kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=nadK PE=3 SV=1 435 564 4.0E-12
sp|Q492C6|NADK_BLOPB NAD kinase OS=Blochmannia pennsylvanicus (strain BPEN) GN=nadK PE=3 SV=1 436 564 6.0E-12
sp|Q7V4D8|NADK2_PROMM NAD kinase 2 OS=Prochlorococcus marinus (strain MIT 9313) GN=nadK2 PE=3 SV=1 280 564 6.0E-12
sp|Q661V4|NADK_BORBP NAD kinase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=nadK PE=3 SV=1 279 496 7.0E-12
sp|B7J4J4|NADK_ACIF2 NAD kinase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=nadK PE=3 SV=1 192 564 8.0E-12
sp|B4RK90|NADK_NEIG2 NAD kinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=nadK PE=3 SV=1 280 541 9.0E-12
sp|Q5F9K3|NADK_NEIG1 NAD kinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nadK PE=3 SV=1 280 541 9.0E-12
sp|B3PJ64|NADK_CELJU NAD kinase OS=Cellvibrio japonicus (strain Ueda107) GN=nadK PE=3 SV=1 280 534 9.0E-12
sp|Q1R8A9|NADK_ECOUT NAD kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|Q8FEY7|NADK_ECOL6 NAD kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|Q0TEM5|NADK_ECOL5 NAD kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|A1AEE5|NADK_ECOK1 NAD kinase OS=Escherichia coli O1:K1 / APEC GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|B7MYQ3|NADK_ECO81 NAD kinase OS=Escherichia coli O81 (strain ED1a) GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|B7MIV2|NADK_ECO45 NAD kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|B7UH63|NADK_ECO27 NAD kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|P73955|NADK2_SYNY3 NAD kinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadK2 PE=3 SV=1 279 497 1.0E-11
sp|A8GI41|NADK_SERP5 NAD kinase OS=Serratia proteamaculans (strain 568) GN=nadK PE=3 SV=1 280 567 1.0E-11
sp|Q31XD1|NADK_SHIBS NAD kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B2SXB6|NADK_BURPP NAD kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=nadK PE=3 SV=1 280 565 1.0E-11
sp|B1LPC2|NADK_ECOSM NAD kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|A1WX34|NADK_HALHL NAD kinase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nadK PE=3 SV=1 440 565 1.0E-11
sp|Q3YYM4|NADK_SHISS NAD kinase OS=Shigella sonnei (strain Ss046) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|P0A7B4|NADK_SHIFL NAD kinase OS=Shigella flexneri GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|Q0T182|NADK_SHIF8 NAD kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B2TYN7|NADK_SHIB3 NAD kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B6I636|NADK_ECOSE NAD kinase OS=Escherichia coli (strain SE11) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B7N6K0|NADK_ECOLU NAD kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|P0A7B3|NADK_ECOLI NAD kinase OS=Escherichia coli (strain K12) GN=nadK PE=1 SV=1 278 567 1.0E-11
sp|B1IVL9|NADK_ECOLC NAD kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|A8A3C1|NADK_ECOHS NAD kinase OS=Escherichia coli O9:H4 (strain HS) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B1XBT5|NADK_ECODH NAD kinase OS=Escherichia coli (strain K12 / DH10B) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|C4ZYN2|NADK_ECOBW NAD kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B7M984|NADK_ECO8A NAD kinase OS=Escherichia coli O8 (strain IAI1) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B7LDK3|NADK_ECO55 NAD kinase OS=Escherichia coli (strain 55989 / EAEC) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|A7ZQ55|NADK_ECO24 NAD kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|B5Z232|NADK_ECO5E NAD kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|P58057|NADK_ECO57 NAD kinase OS=Escherichia coli O157:H7 GN=nadK PE=3 SV=1 278 567 1.0E-11
sp|Q58327|NPPNK_METJA Bifunctional NADP phosphatase/NAD kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0917 PE=1 SV=2 286 537 2.0E-11
sp|Q46JK2|NADK1_PROMT NAD kinase 1 OS=Prochlorococcus marinus (strain NATL2A) GN=nadK1 PE=3 SV=1 276 571 2.0E-11
sp|Q8FTL6|NADK_COREF NAD kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=nadK PE=3 SV=1 280 571 2.0E-11
sp|Q4QPH3|NADK_HAEI8 NAD kinase OS=Haemophilus influenzae (strain 86-028NP) GN=nadK PE=3 SV=2 277 564 3.0E-11
sp|Q8TXD2|NADK_METKA NAD kinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=nadK PE=3 SV=1 280 540 4.0E-11
sp|B2JGE9|NADK_BURP8 NAD kinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=nadK PE=3 SV=1 280 565 4.0E-11
sp|Q83GX6|NADK_TROWT NAD kinase OS=Tropheryma whipplei (strain Twist) GN=nadK PE=3 SV=1 263 542 6.0E-11
sp|Q145F7|NADK_BURXL NAD kinase OS=Burkholderia xenovorans (strain LB400) GN=nadK PE=3 SV=1 280 565 7.0E-11
sp|Q47XI3|NADK_COLP3 NAD kinase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=nadK PE=3 SV=1 431 567 1.0E-10
sp|C1A039|NADK_RHOE4 NAD kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=nadK PE=3 SV=1 280 545 1.0E-10
sp|Q6NHF7|NADK_CORDI NAD kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=nadK PE=3 SV=1 280 555 1.0E-10
sp|O25944|NADK_HELPY NAD kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nadK PE=3 SV=1 280 571 1.0E-10
sp|Q607A2|NADK_METCA NAD kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nadK PE=3 SV=1 280 567 1.0E-10
sp|Q82P98|NADK1_STRAW NAD kinase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nadK1 PE=3 SV=1 280 537 1.0E-10
sp|Q83IC3|NADK_TROW8 NAD kinase OS=Tropheryma whipplei (strain TW08/27) GN=nadK PE=3 SV=1 263 542 1.0E-10
sp|Q30Y32|NADK_DESAG NAD kinase OS=Desulfovibrio alaskensis (strain G20) GN=nadK PE=3 SV=1 440 548 1.0E-10
sp|A6TCM2|NADK_KLEP7 NAD kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nadK PE=3 SV=1 280 567 2.0E-10
sp|B5XVJ8|NADK_KLEP3 NAD kinase OS=Klebsiella pneumoniae (strain 342) GN=nadK PE=3 SV=1 280 567 2.0E-10
sp|Q1CR79|NADK_HELPH NAD kinase OS=Helicobacter pylori (strain HPAG1) GN=nadK PE=3 SV=1 283 571 2.0E-10
sp|A5FS02|NAK_DEHMB NAD kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=nadK PE=3 SV=1 281 530 2.0E-10
sp|A1VCX9|NADK_DESVV NAD kinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=nadK PE=3 SV=1 281 548 2.0E-10
sp|Q72AV2|NADK_DESVH NAD kinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=nadK PE=3 SV=1 281 548 2.0E-10
sp|Q3IKR4|NADK_PSEHT NAD kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=nadK PE=3 SV=1 432 567 3.0E-10
sp|Q3ZZJ0|NADK_DEHMC NAD kinase OS=Dehalococcoides mccartyi (strain CBDB1) GN=nadK PE=3 SV=1 267 530 3.0E-10
sp|B5Z9F8|NADK_HELPG NAD kinase OS=Helicobacter pylori (strain G27) GN=nadK PE=3 SV=1 283 571 3.0E-10
sp|Q89AR9|NADK_BUCBP NAD kinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nadK PE=3 SV=1 280 567 3.0E-10
sp|Q8XW25|NADK_RALSO NAD kinase OS=Ralstonia solanacearum (strain GMI1000) GN=nadK PE=3 SV=1 449 565 3.0E-10
sp|B6JP37|NADK_HELP2 NAD kinase OS=Helicobacter pylori (strain P12) GN=nadK PE=3 SV=1 280 571 3.0E-10
sp|B3DSX1|NADK_BIFLD NAD kinase OS=Bifidobacterium longum (strain DJO10A) GN=nadK PE=3 SV=1 440 538 4.0E-10
sp|B7GTM7|NADK_BIFLS NAD kinase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=nadK PE=3 SV=1 440 538 4.0E-10
sp|Q9ZJ81|NADK_HELPJ NAD kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nadK PE=3 SV=2 283 571 4.0E-10
sp|Q8G5G8|NADK_BIFLO NAD kinase OS=Bifidobacterium longum (strain NCC 2705) GN=nadK PE=3 SV=1 440 538 4.0E-10
sp|Q894H2|NADK_CLOTE NAD kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=nadK PE=3 SV=1 436 562 4.0E-10
sp|Q8K9V8|NADK_BUCAP NAD kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nadK PE=3 SV=1 280 567 4.0E-10
sp|Q2NS01|NADK_SODGM NAD kinase OS=Sodalis glossinidius (strain morsitans) GN=nadK PE=3 SV=1 280 567 4.0E-10
sp|Q3JBV4|NADK_NITOC NAD kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nadK PE=3 SV=1 436 534 5.0E-10
sp|Q3Z997|NAK_DEHM1 NAD kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=nadK PE=3 SV=1 267 541 6.0E-10
sp|Q7VKR8|NADK_HAEDU NAD kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=nadK PE=3 SV=2 280 567 8.0E-10
sp|Q8Z074|NADK2_NOSS1 NAD kinase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=nadK2 PE=3 SV=1 279 564 1.0E-09
sp|Q3M9K5|NADK2_ANAVT NAD kinase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=nadK2 PE=3 SV=1 279 564 1.0E-09
sp|B4EDZ8|NADK_BURCJ NAD kinase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nadK PE=3 SV=1 280 565 2.0E-09
sp|B1JW12|NADK_BURCC NAD kinase OS=Burkholderia cenocepacia (strain MC0-3) GN=nadK PE=3 SV=1 280 565 2.0E-09
sp|A0K4S0|NADK_BURCH NAD kinase OS=Burkholderia cenocepacia (strain HI2424) GN=nadK PE=3 SV=1 280 565 2.0E-09
sp|Q1BYY1|NADK_BURCA NAD kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=nadK PE=3 SV=1 280 565 2.0E-09
sp|Q9RJS6|NADK1_STRCO NAD kinase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nadK1 PE=3 SV=2 280 537 2.0E-09
sp|Q7VRQ5|NADK_BLOFL NAD kinase OS=Blochmannia floridanus GN=nadK PE=3 SV=1 280 507 2.0E-09
sp|C1ASY3|NADK_RHOOB NAD kinase OS=Rhodococcus opacus (strain B4) GN=nadK PE=3 SV=1 280 540 2.0E-09
sp|Q9CNU2|NADK_PASMU NAD kinase OS=Pasteurella multocida (strain Pm70) GN=nadK PE=3 SV=1 281 564 3.0E-09
sp|Q47NA3|NADK_THEFY NAD kinase OS=Thermobifida fusca (strain YX) GN=nadK PE=3 SV=1 450 541 3.0E-09
sp|B8DKV9|NADK_DESVM NAD kinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=nadK PE=3 SV=1 280 485 3.0E-09
sp|Q39JD3|NADK_BURL3 NAD kinase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nadK PE=3 SV=1 280 498 4.0E-09
sp|Q0SI70|NADK_RHOJR NAD kinase OS=Rhodococcus jostii (strain RHA1) GN=nadK PE=3 SV=1 280 540 4.0E-09
sp|Q7NND8|NADK1_GLOVI NAD kinase 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=nadK1 PE=3 SV=1 414 570 4.0E-09
sp|B9DIP5|NADK_STACT NAD kinase OS=Staphylococcus carnosus (strain TM300) GN=nadK PE=3 SV=1 393 497 5.0E-09
sp|Q3IR96|NADK_NATPD NAD kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=nadK PE=3 SV=1 440 541 5.0E-09
sp|Q63R41|NADK_BURPS NAD kinase OS=Burkholderia pseudomallei (strain K96243) GN=nadK PE=3 SV=1 280 565 5.0E-09
sp|Q3JP04|NADK_BURP1 NAD kinase OS=Burkholderia pseudomallei (strain 1710b) GN=nadK PE=3 SV=2 280 565 5.0E-09
sp|B2UVU0|NADK_HELPS NAD kinase OS=Helicobacter pylori (strain Shi470) GN=nadK PE=3 SV=1 283 571 5.0E-09
sp|A9AGC5|NADK_BURM1 NAD kinase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nadK PE=3 SV=1 280 565 6.0E-09
sp|Q8RR32|NADK2_THEEB NAD kinase 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=nadK2 PE=3 SV=1 279 537 7.0E-09
sp|A4JBR4|NADK_BURVG NAD kinase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nadK PE=3 SV=1 280 565 8.0E-09
sp|Q4FRP5|NADK_PSYA2 NAD kinase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=nadK PE=3 SV=2 280 521 8.0E-09
sp|Q6A7W9|NADK_PROAC NAD kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nadK PE=3 SV=1 449 534 1.0E-08
sp|Q2SZ01|NADK_BURTA NAD kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nadK PE=3 SV=1 280 565 1.0E-08
sp|Q8TKQ5|NADK_METAC NAD kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=nadK PE=3 SV=1 436 540 1.0E-08
sp|Q5JEW5|NADK_THEKO NAD kinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=nadK PE=3 SV=1 280 537 2.0E-08
sp|Q1MPL4|NADK_LAWIP NAD kinase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=nadK PE=3 SV=1 283 538 2.0E-08
sp|Q0BI26|NADK_BURCM NAD kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nadK PE=3 SV=1 280 565 2.0E-08
sp|B1YTJ3|NADK_BURA4 NAD kinase OS=Burkholderia ambifaria (strain MC40-6) GN=nadK PE=3 SV=1 280 565 2.0E-08
sp|Q2Y6B0|NADK_NITMU NAD kinase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nadK PE=3 SV=1 440 565 2.0E-08
sp|A1V0T9|NADK_BURMS NAD kinase OS=Burkholderia mallei (strain SAVP1) GN=nadK PE=3 SV=1 283 565 2.0E-08
sp|Q62HC9|NADK_BURMA NAD kinase OS=Burkholderia mallei (strain ATCC 23344) GN=nadK PE=3 SV=1 283 565 2.0E-08
sp|Q46AH3|NADK_METBF NAD kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=nadK PE=3 SV=1 436 540 3.0E-08
sp|B8D789|NADK_BUCAT NAD kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=nadK PE=3 SV=1 428 567 3.0E-08
sp|P57282|NADK_BUCAI NAD kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nadK PE=3 SV=1 428 567 3.0E-08
sp|B8D8Y4|NADK_BUCA5 NAD kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=nadK PE=3 SV=1 428 567 3.0E-08
sp|Q46HL7|NADK2_PROMT NAD kinase 2 OS=Prochlorococcus marinus (strain NATL2A) GN=nadK2 PE=3 SV=1 449 564 4.0E-08
sp|C6A5J6|NADK_THESM NAD kinase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=nadK PE=3 SV=1 432 498 4.0E-08
sp|P65778|NADK_STAAW NAD kinase OS=Staphylococcus aureus (strain MW2) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|A8Z0B0|NADK_STAAT NAD kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|Q6GAS0|NADK_STAAS NAD kinase OS=Staphylococcus aureus (strain MSSA476) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|Q6GI79|NADK_STAAR NAD kinase OS=Staphylococcus aureus (strain MRSA252) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|P65777|NADK_STAAN NAD kinase OS=Staphylococcus aureus (strain N315) GN=nadK PE=1 SV=1 442 497 7.0E-08
sp|P65776|NADK_STAAM NAD kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|A6QFL7|NADK_STAAE NAD kinase OS=Staphylococcus aureus (strain Newman) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|Q5HH78|NADK_STAAC NAD kinase OS=Staphylococcus aureus (strain COL) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|Q2YWX6|NADK_STAAB NAD kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|A5IRI3|NADK_STAA9 NAD kinase OS=Staphylococcus aureus (strain JH9) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|Q2G1Z9|NADK_STAA8 NAD kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|Q2FI70|NADK_STAA3 NAD kinase OS=Staphylococcus aureus (strain USA300) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|A6U0B2|NADK_STAA2 NAD kinase OS=Staphylococcus aureus (strain JH1) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|A7X0N2|NADK_STAA1 NAD kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=nadK PE=3 SV=1 442 497 7.0E-08
sp|Q64P72|NADK_BACFR NAD kinase OS=Bacteroides fragilis (strain YCH46) GN=nadK PE=3 SV=1 440 498 9.0E-08
sp|Q5L911|NADK_BACFN NAD kinase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=nadK PE=3 SV=1 440 498 1.0E-07
sp|Q5UXD1|NADK_HALMA NAD kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=nadK PE=3 SV=1 433 541 1.0E-07
sp|Q04BL3|NADK_LACDB NAD kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=nadK PE=3 SV=1 280 500 2.0E-07
sp|Q1GB65|NADK_LACDA NAD kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=nadK PE=3 SV=1 280 500 2.0E-07
sp|A8YUA3|NADK_LACH4 NAD kinase OS=Lactobacillus helveticus (strain DPC 4571) GN=nadK PE=3 SV=1 436 498 2.0E-07
sp|Q8ERS9|NADK1_OCEIH NAD kinase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=nadK1 PE=3 SV=1 442 497 2.0E-07
sp|Q1WSL8|NADK_LACS1 NAD kinase OS=Lactobacillus salivarius (strain UCC118) GN=nadK PE=3 SV=1 435 486 3.0E-07
sp|Q38VN8|NADK_LACSS NAD kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=nadK PE=3 SV=1 435 497 3.0E-07
sp|Q03QF3|NADK_LACBA NAD kinase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=nadK PE=3 SV=1 436 497 4.0E-07
sp|Q042A7|NADK_LACGA NAD kinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=nadK PE=3 SV=1 380 498 5.0E-07
sp|Q8CT62|NADK_STAES NAD kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=nadK PE=3 SV=1 442 497 5.0E-07
sp|Q5HQG2|NADK_STAEQ NAD kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=nadK PE=3 SV=1 442 497 5.0E-07
sp|Q2NEP6|NADK_METST NAD kinase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=nadK PE=3 SV=1 440 501 6.0E-07
sp|B8GEC2|NADK_METPE NAD kinase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=nadK PE=3 SV=1 449 540 7.0E-07
sp|Q8PTD1|NADK_METMA NAD kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=nadK PE=3 SV=1 449 540 8.0E-07
sp|Q5FL98|NADK_LACAC NAD kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=nadK PE=3 SV=1 436 498 8.0E-07
sp|Q74KC7|NADK_LACJO NAD kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=nadK PE=3 SV=1 441 498 9.0E-07
sp|B2S337|NADK_TREPS NAD kinase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=nadK PE=3 SV=1 279 526 9.0E-07
sp|O83455|NADK_TREPA NAD kinase OS=Treponema pallidum (strain Nichols) GN=nadK PE=3 SV=1 279 526 9.0E-07
sp|Q92D53|NADK1_LISIN NAD kinase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=nadK1 PE=3 SV=1 440 486 1.0E-06
sp|Q8A0V4|NADK_BACTN NAD kinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=nadK PE=3 SV=1 440 498 1.0E-06
sp|C5A3H8|NADK_THEGJ NAD kinase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=nadK PE=3 SV=1 447 537 1.0E-06
sp|Q8Y8D7|NADK1_LISMO NAD kinase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=nadK1 PE=1 SV=1 440 486 2.0E-06
sp|Q721J8|NADK1_LISMF NAD kinase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=nadK1 PE=3 SV=1 440 486 2.0E-06
sp|B0S255|NADK_FINM2 NAD kinase OS=Finegoldia magna (strain ATCC 29328) GN=nadK PE=3 SV=1 430 473 2.0E-06
sp|Q9YD08|NADK_AERPE NAD kinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=nadK PE=3 SV=2 428 534 2.0E-06
sp|Q88V61|NADK_LACPL NAD kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=nadK PE=3 SV=1 436 503 3.0E-06
sp|Q81GJ9|NADK1_BACCR NAD kinase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=nadK1 PE=3 SV=1 425 514 3.0E-06
sp|Q979U7|NADK_THEVO NAD kinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=nadK PE=3 SV=1 436 537 3.0E-06
sp|Q73BU7|NADK1_BACC1 NAD kinase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nadK1 PE=3 SV=1 425 503 3.0E-06
sp|P44497|NADK_HAEIN NAD kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nadK PE=1 SV=3 437 539 3.0E-06
sp|Q6HLY2|NADK1_BACHK NAD kinase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=nadK1 PE=3 SV=1 425 503 3.0E-06
sp|Q63EG5|NADK1_BACCZ NAD kinase 1 OS=Bacillus cereus (strain ZK / E33L) GN=nadK1 PE=3 SV=1 425 503 3.0E-06
sp|Q81TQ3|NADK1_BACAN NAD kinase 1 OS=Bacillus anthracis GN=nadK1 PE=3 SV=1 425 503 3.0E-06
sp|Q03AS0|NADK_LACC3 NAD kinase OS=Lactobacillus casei (strain ATCC 334) GN=nadK PE=3 SV=1 435 486 4.0E-06
sp|Q0AZE0|NADK_SYNWW NAD kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=nadK PE=3 SV=1 449 549 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006741 NADP biosynthetic process Yes
GO:0003951 NAD+ kinase activity Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0019363 pyridine nucleotide biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0008152 metabolic process No
GO:0006739 NADP metabolic process No
GO:0019362 pyridine nucleotide metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019359 nicotinamide nucleotide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0072524 pyridine-containing compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0046496 nicotinamide nucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3200
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6331
Ophiocordyceps australis map64 (Brazil) OphauB2|5814
Ophiocordyceps camponoti-floridani Ophcf2|04868
Ophiocordyceps camponoti-rufipedis Ophun1|4281 (this protein)
Ophiocordyceps kimflemingae Ophio5|206
Ophiocordyceps subramaniannii Hirsu2|5750

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4281
MASAEEKREERDMCGLVDGNDDDGDGDDSKAVTFDPANPYRRKASLVSSEATLPRVRRDQCLVHQFLDYQRRTKD
AADSQQQQHQQHQQQNQPQHHPPTPIAENPVPSVPALQRATLHPTSIDAAYVGQADQQAWTRQMTAGCLPDFDTP
SVDDVVHSRMLTKKQLSDMAWGVRELSRRLSSMRIRFRVNSIFVLTKIHDRDLIVKARDLTRWLLDRDRDVPYVV
YVQDKLESNKTFDAARLVDDVAARYPDADGSRELVRRRLRYWDEAMCRSRPHMFDFVITLGGDGTVLYASWLFQR
IVPPVLSFALGSLGFLTKFDFDDFAPTLDSALNRGVTVSLRLRFETTIMRSIRRKPLANGHSDEHDDAAHRRRDL
VEELIGEERDDAPSHRPDGTYEILNEIVVDRGPNPSEQPPPPVSLFLYFSLTNSQAMSYTELFGDDEHFTSVLAD
GICVSTPTGSTAYNLAAGGSLCHPENPVMLLTSICAHTLTFRPVILPDTIVLRVGVPYNARTSAWASFDGRERVE
LCPGDYVTISASRYPFASVQTEGRRSEDWINSISGKLGWNTRQKQKGYKEWDN*
Coding >Ophun1|4281
ATGGCATCGGCCGAGGAGAAGCGCGAGGAGCGCGATATGTGCGGTCTCGTCGACGGTAACGATGATGATGGCGAT
GGAGACGACTCCAAGGCTGTCACCTTTGATCCGGCCAATCCCTACCGTCGCAAGGCGTCGCTCGTCTCGTCCGAA
GCGACACTCCCGCGCGTCCGACGCGATCAGTGTCTCGTCCATCAGTTTCTCGACTACCAGCGGCGCACAAAAGAT
GCCGCCGACAGCCAGCAGCAGCAACATCAACAACATCAACAACAAAACCAGCCTCAGCATCATCCGCCGACGCCC
ATCGCCGAGAACCCCGTGCCTTCGGTGCCGGCGCTTCAACGCGCCACGCTACATCCGACCTCGATCGATGCCGCC
TACGTCGGTCAGGCAGACCAGCAGGCCTGGACGCGCCAGATGACGGCCGGCTGTCTGCCCGACTTCGATACGCCC
TCGGTCGACGACGTCGTCCACAGCCGCATGCTCACCAAGAAGCAGTTGAGCGACATGGCCTGGGGCGTCAGGGAG
TTGAGCCGTCGCCTCAGCAGCATGCGCATCCGCTTCCGCGTCAACTCCATCTTCGTCCTCACCAAGATTCACGAT
CGGGACCTCATCGTCAAGGCGCGCGACCTGACGCGCTGGCTGTTGGACCGCGATCGCGACGTCCCCTACGTCGTC
TACGTCCAAGATAAGCTCGAATCGAACAAGACGTTCGACGCCGCCCGTCTCGTCGACGACGTCGCCGCCAGATAC
CCGGATGCCGATGGCTCGCGCGAGCTGGTGCGCCGCCGCCTCCGCTACTGGGACGAGGCCATGTGCCGGTCGCGG
CCTCACATGTTTGACTTTGTCATCACTCTCGGCGGCGATGGAACGGTTCTCTACGCCAGCTGGCTTTTTCAGCGC
ATCGTACCGCCCGTTCTGAGTTTTGCCCTCGGTAGTCTGGGCTTCCTGACCAAGTTTGACTTTGACGACTTTGCG
CCCACGCTCGATTCGGCTCTAAACCGGGGCGTCACCGTCAGCCTGCGTCTGCGCTTCGAGACGACCATTATGCGC
AGTATCCGGAGGAAGCCGCTGGCCAATGGCCACTCGGACGAGCATGACGATGCGGCACATCGTCGGAGGGATCTG
GTCGAGGAGCTCATCGGTGAAGAGCGCGATGACGCACCCTCGCATCGTCCGGACGGGACGTACGAGATTCTCAAT
GAGATTGTCGTCGATCGTGGACCGAACCCGAGTGAGCAGCCACCCCCTCCCGTCTCTCTCTTCCTCTACTTCTCG
TTGACGAATTCCCAAGCCATGTCTTACACGGAGCTCTTCGGCGATGACGAGCACTTCACCTCGGTCCTCGCCGAC
GGCATCTGCGTCTCCACGCCAACCGGCTCAACAGCCTACAATCTCGCCGCCGGCGGCTCCCTCTGCCATCCAGAG
AACCCGGTAATGTTACTAACATCCATCTGCGCCCACACGCTCACCTTCCGCCCCGTCATCCTCCCCGACACCATC
GTCCTACGCGTCGGCGTCCCGTACAACGCGCGGACGTCGGCATGGGCCAGCTTCGATGGCCGCGAACGCGTCGAG
CTGTGCCCCGGCGACTACGTCACCATCAGCGCTAGCCGGTACCCCTTTGCGTCTGTACAGACCGAGGGGAGGCGC
AGCGAGGATTGGATCAACAGCATTAGCGGCAAGCTGGGGTGGAACACGAGGCAGAAGCAGAAGGGGTATAAGGAG
TGGGATAACTAG
Transcript >Ophun1|4281
ATGGCATCGGCCGAGGAGAAGCGCGAGGAGCGCGATATGTGCGGTCTCGTCGACGGTAACGATGATGATGGCGAT
GGAGACGACTCCAAGGCTGTCACCTTTGATCCGGCCAATCCCTACCGTCGCAAGGCGTCGCTCGTCTCGTCCGAA
GCGACACTCCCGCGCGTCCGACGCGATCAGTGTCTCGTCCATCAGTTTCTCGACTACCAGCGGCGCACAAAAGAT
GCCGCCGACAGCCAGCAGCAGCAACATCAACAACATCAACAACAAAACCAGCCTCAGCATCATCCGCCGACGCCC
ATCGCCGAGAACCCCGTGCCTTCGGTGCCGGCGCTTCAACGCGCCACGCTACATCCGACCTCGATCGATGCCGCC
TACGTCGGTCAGGCAGACCAGCAGGCCTGGACGCGCCAGATGACGGCCGGCTGTCTGCCCGACTTCGATACGCCC
TCGGTCGACGACGTCGTCCACAGCCGCATGCTCACCAAGAAGCAGTTGAGCGACATGGCCTGGGGCGTCAGGGAG
TTGAGCCGTCGCCTCAGCAGCATGCGCATCCGCTTCCGCGTCAACTCCATCTTCGTCCTCACCAAGATTCACGAT
CGGGACCTCATCGTCAAGGCGCGCGACCTGACGCGCTGGCTGTTGGACCGCGATCGCGACGTCCCCTACGTCGTC
TACGTCCAAGATAAGCTCGAATCGAACAAGACGTTCGACGCCGCCCGTCTCGTCGACGACGTCGCCGCCAGATAC
CCGGATGCCGATGGCTCGCGCGAGCTGGTGCGCCGCCGCCTCCGCTACTGGGACGAGGCCATGTGCCGGTCGCGG
CCTCACATGTTTGACTTTGTCATCACTCTCGGCGGCGATGGAACGGTTCTCTACGCCAGCTGGCTTTTTCAGCGC
ATCGTACCGCCCGTTCTGAGTTTTGCCCTCGGTAGTCTGGGCTTCCTGACCAAGTTTGACTTTGACGACTTTGCG
CCCACGCTCGATTCGGCTCTAAACCGGGGCGTCACCGTCAGCCTGCGTCTGCGCTTCGAGACGACCATTATGCGC
AGTATCCGGAGGAAGCCGCTGGCCAATGGCCACTCGGACGAGCATGACGATGCGGCACATCGTCGGAGGGATCTG
GTCGAGGAGCTCATCGGTGAAGAGCGCGATGACGCACCCTCGCATCGTCCGGACGGGACGTACGAGATTCTCAAT
GAGATTGTCGTCGATCGTGGACCGAACCCGAGTGAGCAGCCACCCCCTCCCGTCTCTCTCTTCCTCTACTTCTCG
TTGACGAATTCCCAAGCCATGTCTTACACGGAGCTCTTCGGCGATGACGAGCACTTCACCTCGGTCCTCGCCGAC
GGCATCTGCGTCTCCACGCCAACCGGCTCAACAGCCTACAATCTCGCCGCCGGCGGCTCCCTCTGCCATCCAGAG
AACCCGGTAATGTTACTAACATCCATCTGCGCCCACACGCTCACCTTCCGCCCCGTCATCCTCCCCGACACCATC
GTCCTACGCGTCGGCGTCCCGTACAACGCGCGGACGTCGGCATGGGCCAGCTTCGATGGCCGCGAACGCGTCGAG
CTGTGCCCCGGCGACTACGTCACCATCAGCGCTAGCCGGTACCCCTTTGCGTCTGTACAGACCGAGGGGAGGCGC
AGCGAGGATTGGATCAACAGCATTAGCGGCAAGCTGGGGTGGAACACGAGGCAGAAGCAGAAGGGGTATAAGGAG
TGGGATAACTAG
Gene >Ophun1|4281
ATGGCATCGGCCGAGGAGAAGCGCGAGGAGCGCGATATGTGCGGTCTCGTCGACGGTAACGATGATGATGGCGAT
GGAGACGACTCCAAGGCTGTTGAGGCGAGTCTGGATCGCGACGGATGGTCCTTGATCACCGACTGACAGACCGGG
CCTCACAGGTCACCTTTGATCCGGCCAATCCCTACCGTCGCAAGGCGTCGCTCGTCTCGTCCGAAGCGACACTCC
CGCGCGTCCGACGCGATCAGTGTCTCGTCCATCAGTTTCTCGACTACCAGCGGCGCACAAAAGATGCCGCCGACA
GCCAGCAGCAGCAACATCAACAACATCAACAACAAAACCAGCCTCAGCATCATCCGCCGACGCCCATCGCCGAGA
ACCCCGTGCCTTCGGTGCCGGCGCTTCAACGCGCCACGCTACATCCGACCTCGATCGATGCCGCCTACGTCGGTC
AGGCAGACCAGCAGGCCTGGACGCGCCAGATGACGGCCGGCTGTCTGCCCGACTTCGATACGCCCTCGGTCGACG
ACGTCGTCCACAGCCGCATGCTCACCAAGAAGCAGTTGAGCGACATGGCCTGGGGCGTCAGGGAGTTGAGCCGTC
GCCTCAGCAGCATGCGCATCCGCTTCCGCGTCAACTCCATCTTCGTCCTCACCAAGATTCACGATCGGGACCTCA
TCGTCAAGGCGCGCGACCTGACGCGCTGGCTGTTGGACCGCGATCGCGACGTCCCCTACGTCGTCTACGTCCAAG
ATAAGCTCGAATCGAACAAGACGTTCGACGCCGCCCGTCTCGTCGACGACGTCGCCGCCAGATACCCGGATGCCG
ATGGCTCGCGCGAGCTGGTGCGCCGCCGCCTCCGCTACTGGGACGAGGCCATGTGCCGGTCGCGGCCTCACATGT
TTGACTTTGTCATCACTCTCGGCGGCGATGGAACGGTTCTCTACGCCAGCTGGCTTTTTCAGCGCATCGTACCGC
CCGTTCTGAGTTTTGCCCTCGGTAGTCTGGGCTTCCTGACCAAGTTTGACTTTGACGACTTTGCGCCCACGCTCG
ATTCGGCTCTAAACCGGGGCGTCACCGTCAGCCTGCGTCTGCGCTTCGAGACGACCATTATGCGCAGTATCCGGA
GGAAGCCGCTGGCCAATGGCCACTCGGACGAGCATGACGATGCGGCACATCGTCGGAGGGATCTGGTCGAGGAGC
TCATCGGTGAAGAGCGCGATGACGCACCCTCGCATCGTCCGGACGGGACGTACGAGATTCTCAATGAGATTGTCG
TCGATCGTGGACCGAACCCGAGTGAGCAGCCACCCCCTCCCGTCTCTCTCTTCCTCTACTTCTCGTTGACGAATT
CCCAAGCCATGTCTTACACGGAGCTCTTCGGCGATGACGAGCACTTCACCTCGGTCCTCGCCGACGGCATCTGCG
TCTCCACGCCAACCGGCTCAACAGCCTACAATCTCGCCGCCGGCGGCTCCCTCTGCCATCCAGAGAACCCGGTAA
TGTTACTAACATCCATCTGCGCCCACACGCTCACCTTCCGCCCCGTCATCCTCCCCGACACCATCGTCCTACGCG
TCGGCGTCCCGTACAACGCGCGGACGTCGGCATGGGCCAGCTTCGATGGCCGCGAACGCGTCGAGCTGTGCCCCG
GCGACTACGTCACCATCAGCGCTAGCCGGTACCCCTTTGCGTCTGTACAGACCGAGGGGAGGCGCAGCGAGGATT
GGATCAACAGCATTAGCGGCAAGCTGGGGTGGAACACGAGGCAGAAGCAGAAGGGGTATAAGGAGTGGGATAACT
AG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail