Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4278
Gene name
LocationContig_395:8126..9879
Strand-
Gene length (bp)1753
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.5

Transmembrane Domains

Domain # Start End Length
1 43 64 21
2 92 114 22
3 129 146 17
4 167 189 22
5 204 226 22
6 247 269 22
7 284 306 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4278
MDGAGLWARASAKLPPDAVTRLSATAPVDDETRLAAETSLRKAFIVLAVINCLVGAVTALGIYVDCRLKLTRKGV
PLSGKSPFIVIGAKEMLPFVVSLGIVAQGALFGAAQTNGLDSVLALGCRGVSQIMLPALLIVPLIQLVFGIEATV
RSVPRRPVVRGPGWLRPVLAGLVAIGLVVAYGLTFMAEAPNFCFAELLFLVKHWSEGILALFTSIGVLLLLCSGI
IMLRLYRTPDMMLPQRTTASWTACYLLLAVLTLFMTLPVFGSLLADDGVSDISRGTMVLSTGATIIINMTGVLTG
VLYLVLRLTRLGRLGEVEFDRDRLKSDIRTVGTSSSVYSKQLDQPLSPEWFQRPSYGSRADEKKAMSKTPIPPKA
GAPSYNLFPKRPDAAPTLLIPPTAPWANRSERNSSLGSSASVPIALRVSNIDMLPMEPESQTAAPNLGLAISTYG
DQAAAYLASKNSAVFDFDDDELEAPPPLVVTKATPDDFTLSPSVYSPESSSSSSVESVYKPESLSGESVYSPESS
SGGSVRMPPPSLHGGRGRSR*
Coding >Ophun1|4278
ATGGACGGAGCTGGTCTGTGGGCGAGAGCCTCTGCCAAGCTGCCGCCTGATGCCGTTACGCGATTGAGCGCCACG
GCCCCCGTCGACGACGAGACGCGGTTGGCGGCCGAGACGTCGCTTCGCAAGGCCTTTATCGTCTTGGCCGTCATC
AACTGTCTGGTCGGGGCCGTGACGGCACTGGGCATCTATGTCGATTGCCGGCTGAAATTGACGAGGAAGGGCGTG
CCGCTGTCTGGGAAGTCGCCCTTCATCGTCATCGGCGCCAAGGAGATGCTCCCCTTCGTCGTCTCGCTCGGAATC
GTCGCACAAGGCGCTCTTTTCGGCGCGGCTCAGACAAACGGACTGGACTCGGTTCTGGCGCTGGGCTGCAGAGGC
GTCTCGCAGATAATGCTGCCAGCCCTCTTGATCGTGCCCTTGATCCAGCTCGTCTTTGGCATCGAGGCCACGGTA
CGTTCGGTGCCTCGTCGGCCGGTGGTCAGGGGCCCGGGCTGGCTACGACCCGTGTTGGCGGGCCTGGTAGCGATT
GGGCTCGTGGTCGCCTATGGCTTGACCTTTATGGCGGAGGCGCCCAACTTTTGCTTCGCCGAGCTGCTGTTCCTG
GTGAAGCACTGGAGCGAAGGCATCTTGGCCCTGTTTACCTCCATCGGCGTCCTGCTACTGCTCTGCAGTGGCATT
ATAATGCTGCGCCTCTACCGGACGCCGGACATGATGCTTCCTCAGCGGACGACGGCATCCTGGACGGCGTGCTAT
CTCCTTTTGGCCGTCCTCACCTTGTTCATGACGCTGCCTGTGTTTGGAAGTCTCTTGGCCGACGACGGCGTGTCG
GACATCTCGCGGGGCACCATGGTGCTATCGACGGGGGCTACCATCATTATCAACATGACGGGCGTCCTGACTGGC
GTCCTCTATCTTGTCCTGCGTCTGACGAGGCTCGGCCGGCTGGGAGAGGTCGAGTTTGATCGGGACCGGCTCAAG
TCGGACATCCGGACCGTTGGCACCAGCAGCAGCGTCTACAGCAAGCAGCTGGACCAGCCGCTGTCTCCGGAATGG
TTTCAACGTCCCTCATACGGCAGCAGAGCAGACGAGAAGAAGGCCATGTCCAAGACGCCTATCCCGCCCAAGGCC
GGGGCGCCGTCGTACAACCTCTTCCCCAAACGGCCAGACGCCGCGCCGACGCTCCTCATACCCCCGACAGCCCCG
TGGGCGAACCGCAGCGAGCGCAACTCTTCGCTCGGCTCATCGGCCTCGGTCCCGATCGCGCTGCGCGTCTCCAAC
ATTGACATGCTGCCGATGGAGCCGGAGTCGCAGACGGCGGCGCCGAACCTGGGCCTCGCCATCAGCACCTACGGG
GACCAGGCGGCCGCCTACCTGGCGTCCAAGAACTCGGCCGTCTTCGACTTTGACGACGACGAGTTGGAGGCCCCG
CCTCCGCTGGTGGTGACCAAGGCCACGCCCGATGACTTTACCCTCAGCCCTAGCGTCTACAGCCCTGAGTCGTCG
TCGTCGTCGTCTGTGGAGTCGGTTTACAAGCCTGAGTCGCTGTCCGGGGAATCGGTTTACAGTCCTGAGTCGTCG
TCTGGGGGGTCGGTTCGGATGCCGCCGCCTAGCCTCCACGGGGGTCGGGGCCGGAGCAGATGA
Transcript >Ophun1|4278
ATGGACGGAGCTGGTCTGTGGGCGAGAGCCTCTGCCAAGCTGCCGCCTGATGCCGTTACGCGATTGAGCGCCACG
GCCCCCGTCGACGACGAGACGCGGTTGGCGGCCGAGACGTCGCTTCGCAAGGCCTTTATCGTCTTGGCCGTCATC
AACTGTCTGGTCGGGGCCGTGACGGCACTGGGCATCTATGTCGATTGCCGGCTGAAATTGACGAGGAAGGGCGTG
CCGCTGTCTGGGAAGTCGCCCTTCATCGTCATCGGCGCCAAGGAGATGCTCCCCTTCGTCGTCTCGCTCGGAATC
GTCGCACAAGGCGCTCTTTTCGGCGCGGCTCAGACAAACGGACTGGACTCGGTTCTGGCGCTGGGCTGCAGAGGC
GTCTCGCAGATAATGCTGCCAGCCCTCTTGATCGTGCCCTTGATCCAGCTCGTCTTTGGCATCGAGGCCACGGTA
CGTTCGGTGCCTCGTCGGCCGGTGGTCAGGGGCCCGGGCTGGCTACGACCCGTGTTGGCGGGCCTGGTAGCGATT
GGGCTCGTGGTCGCCTATGGCTTGACCTTTATGGCGGAGGCGCCCAACTTTTGCTTCGCCGAGCTGCTGTTCCTG
GTGAAGCACTGGAGCGAAGGCATCTTGGCCCTGTTTACCTCCATCGGCGTCCTGCTACTGCTCTGCAGTGGCATT
ATAATGCTGCGCCTCTACCGGACGCCGGACATGATGCTTCCTCAGCGGACGACGGCATCCTGGACGGCGTGCTAT
CTCCTTTTGGCCGTCCTCACCTTGTTCATGACGCTGCCTGTGTTTGGAAGTCTCTTGGCCGACGACGGCGTGTCG
GACATCTCGCGGGGCACCATGGTGCTATCGACGGGGGCTACCATCATTATCAACATGACGGGCGTCCTGACTGGC
GTCCTCTATCTTGTCCTGCGTCTGACGAGGCTCGGCCGGCTGGGAGAGGTCGAGTTTGATCGGGACCGGCTCAAG
TCGGACATCCGGACCGTTGGCACCAGCAGCAGCGTCTACAGCAAGCAGCTGGACCAGCCGCTGTCTCCGGAATGG
TTTCAACGTCCCTCATACGGCAGCAGAGCAGACGAGAAGAAGGCCATGTCCAAGACGCCTATCCCGCCCAAGGCC
GGGGCGCCGTCGTACAACCTCTTCCCCAAACGGCCAGACGCCGCGCCGACGCTCCTCATACCCCCGACAGCCCCG
TGGGCGAACCGCAGCGAGCGCAACTCTTCGCTCGGCTCATCGGCCTCGGTCCCGATCGCGCTGCGCGTCTCCAAC
ATTGACATGCTGCCGATGGAGCCGGAGTCGCAGACGGCGGCGCCGAACCTGGGCCTCGCCATCAGCACCTACGGG
GACCAGGCGGCCGCCTACCTGGCGTCCAAGAACTCGGCCGTCTTCGACTTTGACGACGACGAGTTGGAGGCCCCG
CCTCCGCTGGTGGTGACCAAGGCCACGCCCGATGACTTTACCCTCAGCCCTAGCGTCTACAGCCCTGAGTCGTCG
TCGTCGTCGTCTGTGGAGTCGGTTTACAAGCCTGAGTCGCTGTCCGGGGAATCGGTTTACAGTCCTGAGTCGTCG
TCTGGGGGGTCGGTTCGGATGCCGCCGCCTAGCCTCCACGGGGGTCGGGGCCGGAGCAGATGA
Gene >Ophun1|4278
ATGGACGGAGCTGGTCTGTGGGCGAGAGCCTCTGCCAAGCTGCCGCCTGATGCCGTTACGCGATTGAGCGCCACG
GCCCCCGTCGACGACGAGACGCGGTTGGCGGCCGAGACGTCGCTTCGCAAGGCCTTTATCGTCTTGGCCGTCATC
AACTGTCTGGTCGGGGCCGTGACGGCACTGGGCATCTATGTCGATTGCCGGCTGAAATTGACGAGGAAGGGCGTG
CCGCTGTCTGGGTAGGGCTCACAACTCTCATGTCTGTATACTGTAGGCCGAGAGACTGACGAGGAATTTATAGGA
AGTCGCCCTTCATCGTCATCGGCGCCAAGGAGATGCTCCCCTTCGTCGTCTCGCTCGGAATCGTCGCACAAGGCG
CTCTTTTCGGCGCGGCTCAGACAAACGGACTGGACTCGGTTCTGGCGCTGGGCTGCAGAGGCGTCTCGCAGATAA
TGCTGCCAGGTACGGGATTGTTCGCCAGCCAGAACCAGGTCGTGATGCTGACAGAGAAGCAGCCCTCTTGATCGT
GCCCTTGATCCAGCTCGTCTTTGGCATCGAGGCCACGGTACGTTCGGTGCCTCGTCGGCCGGTGGTCAGGGGCCC
GGGCTGGCTACGACCCGTGTTGGCGGGCCTGGTAGCGATTGGGCTCGTGGTCGCCTATGGCTTGACCTTTATGGC
GGAGGCGCCCAACTTTTGCTTCGCCGAGCTGCTGTTCCTGGTGAAGCACTGGAGCGAAGGCATCTTGGCCCTGTT
TACCTCCATCGGCGTCCTGCTACTGCTCTGCAGTGGCATTATAATGCTGCGCCTCTACCGGACGCCGGACATGAT
GCTTCCTCAGCGGACGACGGCATCCTGGACGGCGTGCTATCTCCTTTTGGCCGTCCTCACCTTGTTCATGACGCT
GCCTGTGTTTGGAAGTCTCTTGGCCGACGACGGCGTGTCGGACATCTCGCGGGGCACCATGGTGCTATCGACGGG
GGCTACCATCATTATCAACATGACGGGCGTCCTGACTGGCGTCCTCTATCTTGTCCTGCGTCTGACGAGGCTCGG
CCGGCTGGGAGAGGTCGAGTTTGATCGGGACCGGCTCAAGTCGGACATCCGGACCGTTGGCACCAGCAGCAGCGT
CTACAGCAAGCAGCTGGACCAGCCGCTGTCTCCGGAATGGTTTCAACGTCCCTCATACGGCAGCAGAGCAGACGA
GAAGAAGGCCATGTCCAAGACGCCTATCCCGCCCAAGGCCGGGGCGCCGTCGTACAACCTCTTCCCCAAACGGCC
AGACGCCGCGCCGACGCTCCTCATACCCCCGACAGCCCCGTGGGCGAACCGCAGCGAGCGCAACTCTTCGCTCGG
CTCATCGGCCTCGGTCCCGATCGCGCTGCGCGTCTCCAACATTGACATGCTGCCGATGGAGCCGGAGTCGCAGAC
GGCGGCGCCGAACCTGGGCCTCGCCATCAGCACCTACGGGGACCAGGCGGCCGCCTACCTGGCGTCCAAGAACTC
GGCCGTCTTCGACTTTGACGACGACGAGTTGGAGGCCCCGCCTCCGCTGGTGGTGACCAAGGCCACGCCCGATGA
CTTTACCCTCAGCCCTAGCGTCTACAGCCCTGAGTCGTCGTCGTCGTCGTCTGTGGAGTCGGTTTACAAGCCTGA
GTCGCTGTCCGGGGAATCGGTTTACAGTCCTGAGTCGTCGTCTGGGGGGTCGGTTCGGATGCCGCCGCCTAGCCT
CCACGGGGGTCGGGGCCGGAGCAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail