Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4275
Gene name
LocationContig_395:109..721
Strand+
Gene length (bp)612
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 5.4E-16 13 141
PF01230 HIT HIT domain 1.1E-14 15 131
PF16278 zf-C2HE C2HE / C2H2 / C2HC zinc-binding finger 9.5E-14 146 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74859|APTX_SCHPO Aprataxin-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt3 PE=1 SV=1 2 201 2.0E-34
sp|Q08702|APTX_YEAST Aprataxin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT3 PE=1 SV=1 2 199 2.0E-31
sp|P61800|APTX_TAKRU Aprataxin OS=Takifugu rubripes GN=aptx PE=2 SV=1 11 198 2.0E-17
sp|P61799|APTX_DANRE Aprataxin OS=Danio rerio GN=aptx PE=2 SV=1 11 195 3.0E-16
sp|P61798|APTX_CHICK Aprataxin (Fragment) OS=Gallus gallus GN=APTX PE=2 SV=1 11 158 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74859|APTX_SCHPO Aprataxin-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt3 PE=1 SV=1 2 201 2.0E-34
sp|Q08702|APTX_YEAST Aprataxin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT3 PE=1 SV=1 2 199 2.0E-31
sp|P61800|APTX_TAKRU Aprataxin OS=Takifugu rubripes GN=aptx PE=2 SV=1 11 198 2.0E-17
sp|P61799|APTX_DANRE Aprataxin OS=Danio rerio GN=aptx PE=2 SV=1 11 195 3.0E-16
sp|P61798|APTX_CHICK Aprataxin (Fragment) OS=Gallus gallus GN=APTX PE=2 SV=1 11 158 1.0E-14
sp|P61802|APTX_CIOIN Aprataxin OS=Ciona intestinalis GN=APTX PE=2 SV=1 11 195 4.0E-14
sp|Q9M041|BH140_ARATH Transcription factor bHLH140 OS=Arabidopsis thaliana GN=BHLH140 PE=3 SV=1 1 194 5.0E-14
sp|P61801|APTX_XENTR Aprataxin OS=Xenopus tropicalis GN=aptx PE=2 SV=1 11 195 6.0E-14
sp|Q7T287|APTX_XENLA Aprataxin OS=Xenopus laevis GN=aptx PE=2 SV=1 11 195 2.0E-13
sp|Q558W0|Y2839_DICDI HIT domain-containing protein DDB_G0272839 OS=Dictyostelium discoideum GN=DDB_G0272839 PE=2 SV=1 6 155 2.0E-12
sp|Q7YRZ1|APTX_PIG Aprataxin OS=Sus scrofa GN=APTX PE=2 SV=1 11 194 3.0E-12
sp|Q7Z2E3|APTX_HUMAN Aprataxin OS=Homo sapiens GN=APTX PE=1 SV=2 11 166 4.0E-12
sp|Q8K4H4|APTX_RAT Aprataxin OS=Rattus norvegicus GN=Aptx PE=2 SV=1 11 151 5.0E-12
sp|Q7TQC5|APTX_MOUSE Aprataxin OS=Mus musculus GN=Aptx PE=1 SV=2 15 151 5.0E-12
sp|P61797|APTX_CANLF Aprataxin OS=Canis lupus familiaris GN=APTX PE=2 SV=1 11 151 8.0E-12
sp|Q9BGQ0|APTX_MACFA Aprataxin OS=Macaca fascicularis GN=APTX PE=2 SV=1 11 194 8.0E-12
sp|Q7YRZ2|APTX_BOVIN Aprataxin OS=Bos taurus GN=APTX PE=2 SV=1 11 194 1.0E-11
sp|Q8MSG8|APTX_DROME Aprataxin-like protein OS=Drosophila melanogaster GN=CG5316 PE=2 SV=2 15 194 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5337
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|825
Ophiocordyceps australis map64 (Brazil) OphauB2|5822
Ophiocordyceps camponoti-floridani Ophcf2|04860
Ophiocordyceps camponoti-rufipedis Ophun1|4275 (this protein)
Ophiocordyceps kimflemingae Ophio5|802
Ophiocordyceps subramaniannii Hirsu2|5095

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4275
MGLGTYITNPSSHPPSTIIYHDDNFVALRDRYPKATVHALLLPRDEQLALRHPLEALAHPHVRALFEAELPKLVR
LVAMELKRVLSSAHDHQDPHDPSPPPERDWSKEIIAGVHTNPSMRHLHIHVLSRDMHSPALRHRKHYNSFTTPFF
VRLDEFPEAAAQQAVRGRRLRDELVCWRCGRAFGDRFAGLKAHLEDEFGVWRG*
Coding >Ophun1|4275
ATGGGACTGGGAACCTACATCACCAACCCATCCTCGCACCCGCCCTCAACAATCATCTACCACGACGACAACTTC
GTCGCCCTGCGGGATCGTTACCCCAAGGCCACCGTCCACGCCCTCCTCCTCCCCCGCGATGAGCAGCTCGCGCTG
AGGCATCCGCTCGAGGCGCTCGCCCATCCCCATGTCAGGGCTCTGTTCGAGGCCGAGTTGCCCAAGTTGGTGAGG
CTGGTGGCCATGGAGTTGAAGAGGGTCCTCTCCTCGGCACATGACCACCAAGACCCTCACGACCCCTCACCCCCC
CCCGAGCGAGACTGGTCAAAGGAGATAATCGCGGGCGTGCACACGAACCCCAGCATGCGCCACCTGCACATCCAC
GTCCTCTCGCGCGACATGCACTCGCCCGCCCTCCGCCACCGCAAGCACTACAACTCGTTCACCACGCCCTTCTTC
GTCCGCCTCGACGAGTTTCCCGAGGCGGCGGCCCAGCAGGCCGTCCGAGGGCGCAGGCTGCGCGATGAGCTTGTG
TGCTGGCGGTGTGGGAGGGCGTTTGGGGATCGGTTTGCCGGGTTGAAGGCGCATCTTGAGGACGAGTTTGGGGTT
TGGAGGGGGTGA
Transcript >Ophun1|4275
ATGGGACTGGGAACCTACATCACCAACCCATCCTCGCACCCGCCCTCAACAATCATCTACCACGACGACAACTTC
GTCGCCCTGCGGGATCGTTACCCCAAGGCCACCGTCCACGCCCTCCTCCTCCCCCGCGATGAGCAGCTCGCGCTG
AGGCATCCGCTCGAGGCGCTCGCCCATCCCCATGTCAGGGCTCTGTTCGAGGCCGAGTTGCCCAAGTTGGTGAGG
CTGGTGGCCATGGAGTTGAAGAGGGTCCTCTCCTCGGCACATGACCACCAAGACCCTCACGACCCCTCACCCCCC
CCCGAGCGAGACTGGTCAAAGGAGATAATCGCGGGCGTGCACACGAACCCCAGCATGCGCCACCTGCACATCCAC
GTCCTCTCGCGCGACATGCACTCGCCCGCCCTCCGCCACCGCAAGCACTACAACTCGTTCACCACGCCCTTCTTC
GTCCGCCTCGACGAGTTTCCCGAGGCGGCGGCCCAGCAGGCCGTCCGAGGGCGCAGGCTGCGCGATGAGCTTGTG
TGCTGGCGGTGTGGGAGGGCGTTTGGGGATCGGTTTGCCGGGTTGAAGGCGCATCTTGAGGACGAGTTTGGGGTT
TGGAGGGGGTGA
Gene >Ophun1|4275
ATGGGACTGGGAACCTACATCACCAACCCATCCTCGCACCCGCCCTCAACAATCATCTACCACGACGACAACTTC
GTCGCCCTGCGGGATCGTTACCCCAAGGCCACCGTCCACGCCCTCCTCCTCCCCCGCGATGAGCAGCTCGCGCTG
AGGCATCCGCTCGAGGCGCTCGCCCATCCCCATGTCAGGGCTCTGTTCGAGGCCGAGTTGCCCAAGTTGGTGAGG
CTGGTGGCCATGGAGTTGAAGAGGGTCCTCTCCTCGGCACATGACCACCAAGACCCTCACGACCCCTCACCCCCC
CCCGAGCGAGACTGGTCAAAGGAGATAATCGCGGGCGTGCACACGAACCCCAGCATGCGCCACCTGCACATCCAC
GTCCTCTCGCGCGACATGCACTCGCCCGCCCTCCGCCACCGCAAGCACTACAACTCGTTCACCACGCCCTTCTTC
GTCCGCCTCGACGAGTTTCCCGAGGCGGCGGCCCAGCAGGCCGTCCGAGGGCGCAGGCTGCGCGATGAGCTTGTG
TGCTGGCGGTGTGGGAGGGCGTTTGGGGATCGGTTTGCCGGGTTGAAGGCGCATCTTGAGGACGAGTTTGGGGTT
TGGAGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail