Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4270
Gene name
LocationContig_394:7151..8569
Strand-
Gene length (bp)1418
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 2.7E-40 80 312
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.8E-14 85 314
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 9.0E-11 84 197
PF20408 Abhydrolase_11 Alpha/beta hydrolase domain 2.0E-07 82 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 70 334 4.0E-38
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 60 333 4.0E-22
sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 51 330 3.0E-15
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 62 333 9.0E-15
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 62 333 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 70 334 4.0E-38
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 60 333 4.0E-22
sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 51 330 3.0E-15
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 62 333 9.0E-15
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 62 333 4.0E-14
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 62 338 4.0E-13
sp|O34705|PLBAC_BACSU Phospholipase YtpA OS=Bacillus subtilis (strain 168) GN=ytpA PE=1 SV=1 83 327 3.0E-09
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 80 169 4.0E-06
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 80 169 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4270
MAQLGVALVSLSASPCSVARSQARLASLIKAKDLRTWSRLSPSKASALPRYLMAVKTVEATLTAADGHALYTKAW
EAPHAARAVLVWLHGFGDHCDRAAAFFTTLASRGISVHAFDQRGWGRSVIDPSDRGSPGTTDIILSDMTVIVDRL
RNRTDLPLFLGGHSMGGGLVLLWAAQAPIQTRRSIRGFIAEAPLLRLHPSCKPSPGMLWLARRLAIFCPSLPVRH
GYNRDDQPVDPLVQDVASLSVTLDIWDRGELIATGRCDLNDQDTGLMLALGGDDFVICPDAVKAYFDRSGLEDKQ
LRSYAGCGHELHDQGGSEKGSFTDDLVQWLSDRAPDYG*
Coding >Ophun1|4270
ATGGCGCAACTAGGCGTCGCCCTAGTCTCCCTCAGCGCCTCACCTTGTTCCGTTGCCAGGTCACAGGCTCGACTC
GCCTCATTGATCAAGGCCAAGGACCTTCGGACATGGAGCCGGCTCTCGCCGTCCAAGGCTTCGGCCCTACCGCGA
TACCTGATGGCAGTTAAGACGGTCGAGGCTACGCTCACGGCCGCTGACGGCCATGCGCTGTACACTAAAGCTTGG
GAGGCTCCGCATGCTGCCAGAGCAGTCCTCGTCTGGCTCCATGGCTTCGGCGATCACTGTGACCGCGCGGCTGCA
TTCTTCACCACCTTGGCCAGCCGTGGCATCTCTGTCCATGCCTTTGACCAGCGCGGATGGGGACGCTCCGTCATC
GACCCGTCAGATCGGGGCTCCCCCGGCACGACGGACATCATCTTATCCGACATGACGGTCATCGTCGACCGACTA
CGTAACCGCACCGACTTGCCTCTCTTCCTCGGGGGTCATAGCATGGGCGGTGGTCTGGTTCTGCTCTGGGCGGCC
CAGGCCCCGATACAAACTCGGCGCTCGATTCGCGGCTTCATCGCCGAGGCACCGCTCCTGCGCCTTCACCCGTCT
TGCAAGCCTTCTCCTGGCATGTTGTGGCTCGCTCGCCGTCTCGCCATATTCTGTCCTAGCCTGCCGGTACGTCAT
GGGTATAATCGCGATGACCAGCCAGTCGACCCGCTCGTCCAGGACGTCGCCTCTCTAAGCGTCACGCTCGACATT
TGGGATCGCGGCGAGCTCATCGCTACCGGGCGGTGCGATTTGAATGACCAAGATACGGGCTTGATGCTTGCTCTC
GGAGGGGACGACTTCGTTATTTGCCCCGATGCTGTGAAGGCGTACTTTGATCGCTCGGGGCTGGAGGATAAGCAG
CTGCGCAGTTATGCTGGGTGCGGGCATGAGCTTCATGATCAGGGGGGCTCGGAAAAGGGGTCTTTTACTGATGAT
CTTGTCCAGTGGTTAAGCGACAGAGCGCCGGATTATGGCTGA
Transcript >Ophun1|4270
ATGGCGCAACTAGGCGTCGCCCTAGTCTCCCTCAGCGCCTCACCTTGTTCCGTTGCCAGGTCACAGGCTCGACTC
GCCTCATTGATCAAGGCCAAGGACCTTCGGACATGGAGCCGGCTCTCGCCGTCCAAGGCTTCGGCCCTACCGCGA
TACCTGATGGCAGTTAAGACGGTCGAGGCTACGCTCACGGCCGCTGACGGCCATGCGCTGTACACTAAAGCTTGG
GAGGCTCCGCATGCTGCCAGAGCAGTCCTCGTCTGGCTCCATGGCTTCGGCGATCACTGTGACCGCGCGGCTGCA
TTCTTCACCACCTTGGCCAGCCGTGGCATCTCTGTCCATGCCTTTGACCAGCGCGGATGGGGACGCTCCGTCATC
GACCCGTCAGATCGGGGCTCCCCCGGCACGACGGACATCATCTTATCCGACATGACGGTCATCGTCGACCGACTA
CGTAACCGCACCGACTTGCCTCTCTTCCTCGGGGGTCATAGCATGGGCGGTGGTCTGGTTCTGCTCTGGGCGGCC
CAGGCCCCGATACAAACTCGGCGCTCGATTCGCGGCTTCATCGCCGAGGCACCGCTCCTGCGCCTTCACCCGTCT
TGCAAGCCTTCTCCTGGCATGTTGTGGCTCGCTCGCCGTCTCGCCATATTCTGTCCTAGCCTGCCGGTACGTCAT
GGGTATAATCGCGATGACCAGCCAGTCGACCCGCTCGTCCAGGACGTCGCCTCTCTAAGCGTCACGCTCGACATT
TGGGATCGCGGCGAGCTCATCGCTACCGGGCGGTGCGATTTGAATGACCAAGATACGGGCTTGATGCTTGCTCTC
GGAGGGGACGACTTCGTTATTTGCCCCGATGCTGTGAAGGCGTACTTTGATCGCTCGGGGCTGGAGGATAAGCAG
CTGCGCAGTTATGCTGGGTGCGGGCATGAGCTTCATGATCAGGGGGGCTCGGAAAAGGGGTCTTTTACTGATGAT
CTTGTCCAGTGGTTAAGCGACAGAGCGCCGGATTATGGCTGA
Gene >Ophun1|4270
ATGGCGCAACTAGGGTGCGAATCCTGCTGGACGCGGTGGGGTTTTCCGAGACCGACGTCAGTCTGTCTGTGTCTG
TCTGTCGTGATGAGGAGTTGACCTGCACAGAGAGTTGGACGTCGTCAGGCCGACTGCTTAGTCACCTCTCCAACT
TGCCCTCTCCGACTGAACCCTCTCCATCTTGCTCTCCCACGGGAAAAGGGATCTCCCACCCGGAGTCCAGCCGGA
GTGGCTTTCTCCTGCAGCCTCGCCCTCCCTTGGCCGGTCTCAGACTGTCGACGCCCACCGGAATGGCCTCTGCTC
GTCACCTTGCGGCCTCGGGCTGGACCGCCCTTGGAGACGTTTCACACGCCAGCATAGCGTCGCCCTAGTCTCCCT
CAGCGCCTCACCTTGTTCCGTTGCCAGGTCACAGGCTCGACTCGCCTCATTGATCAAGGCCAAGGACCTTCGGAC
ATGGAGCCGGCTCTCGCCGTCCAAGGCTTCGGCCCTACCGCGATACCTGATGGCAGTTAAGACGGTCGAGGCTAC
GCTCACGGCCGCTGACGGCCATGCGCTGTACACTAAAGCTTGGGAGGTGAGTCTAGACCGCAGACAGATGCCGGT
CTGGCGCCCGCATCTAACAAGGCATACAGGCTCCGCATGCTGCCAGAGCAGTCCTCGTCTGGCTCCATGGCTTCG
GCGATCACTGTGACCGCGCGGCTGCATTCTTCACCACCTTGGCCAGCCGTGGCATCTCTGTCCATGCCTTTGACC
AGCGCGGATGGGGACGCTCCGTCATCGACCCGTCAGATCGGGGCTCCCCCGGCACGACGGACATCATCTTATCCG
ACATGACGGTCATCGTCGACCGACTACGTAACCGCACCGACTTGCCTCTCTTCCTCGGGGGTCATAGCATGGGCG
GTGGTCTGGTTCTGCTCTGGGCGGCCCAGGCCCCGATACAAACTCGGCGCTCGATTCGCGGCTTCATCGCCGAGG
CACCGCTCCTGCGCCTTCACCCGTCTTGCAAGCCTTCTCCTGGCATGTTGTGGCTCGCTCGCCGTCTCGCCATAT
TCTGTCCTAGCCTGCCGGTACGTCATGGGTATAATCGCGATGACCAGCCAGTCGACCCGCTCGTCCAGGACGTCG
CCTCTCTAAGCGTCACGCTCGACATTTGGGATCGCGGCGAGCTCATCGCTACCGGGCGGTGCGATTTGAATGACC
AAGATACGGGCTTGATGCTTGCTCTCGGAGGGGACGACTTCGTTATTTGCCCCGATGCTGTGAAGGCGTACTTTG
ATCGCTCGGGGCTGGAGGATAAGCAGCTGCGCAGTTATGCTGGGTGCGGGCATGAGCTTCATGATCAGGGGGGCT
CGGAAAAGGGGTCTTTTACTGATGATCTTGTCCAGTGGTTAAGCGACAGAGCGCCGGATTATGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail