Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4268
Gene name
LocationContig_394:5059..5542
Strand+
Gene length (bp)483
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09811 Yae1_N Essential protein Yae1, N terminal 8.4E-08 20 58

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q1|YQ68_SCHPO Uncharacterized ORAOV1 family protein C191.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.08 PE=3 SV=1 7 159 2.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3744
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4989
Ophiocordyceps australis map64 (Brazil) OphauB2|624
Ophiocordyceps camponoti-floridani Ophcf2|06820
Ophiocordyceps camponoti-rufipedis Ophun1|4268 (this protein)
Ophiocordyceps kimflemingae Ophio5|308
Ophiocordyceps subramaniannii Hirsu2|73

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4268
MTSDPLEDVLHLEDRYYREGYQQGLDDGARAGHAEGRTFGLEKGLEKFLEGGRLAGRAVVWANRLPRRQDVTPEN
LPHRKDDDKPTVADASQPNSSSRPKRCELPPLPENTRIERNVRALYALVEPGTLSTENTDEAVQDFDSRMKRAQG
KAKIIERALS*
Coding >Ophun1|4268
ATGACGTCGGACCCCCTCGAAGATGTCCTTCACCTCGAGGACCGCTACTACCGCGAGGGCTACCAGCAAGGCCTC
GACGACGGCGCCAGAGCCGGACACGCCGAAGGCCGCACCTTTGGCCTGGAGAAGGGCCTCGAAAAGTTTCTCGAA
GGAGGTCGCCTGGCTGGAAGGGCTGTCGTCTGGGCCAATAGATTACCTCGTCGACAAGACGTCACGCCCGAAAAC
CTGCCTCATCGGAAGGACGACGACAAGCCAACAGTAGCGGACGCCAGCCAACCCAACTCCTCCTCTCGCCCCAAG
CGCTGTGAATTACCGCCGCTTCCCGAAAATACGCGCATCGAGAGAAACGTCAGGGCGCTCTACGCGCTCGTCGAG
CCGGGAACGCTCTCGACGGAAAACACGGACGAGGCGGTGCAGGATTTCGACAGCCGCATGAAGCGGGCGCAGGGA
AAGGCAAAGATAATTGAGCGAGCCCTCAGCTAA
Transcript >Ophun1|4268
ATGACGTCGGACCCCCTCGAAGATGTCCTTCACCTCGAGGACCGCTACTACCGCGAGGGCTACCAGCAAGGCCTC
GACGACGGCGCCAGAGCCGGACACGCCGAAGGCCGCACCTTTGGCCTGGAGAAGGGCCTCGAAAAGTTTCTCGAA
GGAGGTCGCCTGGCTGGAAGGGCTGTCGTCTGGGCCAATAGATTACCTCGTCGACAAGACGTCACGCCCGAAAAC
CTGCCTCATCGGAAGGACGACGACAAGCCAACAGTAGCGGACGCCAGCCAACCCAACTCCTCCTCTCGCCCCAAG
CGCTGTGAATTACCGCCGCTTCCCGAAAATACGCGCATCGAGAGAAACGTCAGGGCGCTCTACGCGCTCGTCGAG
CCGGGAACGCTCTCGACGGAAAACACGGACGAGGCGGTGCAGGATTTCGACAGCCGCATGAAGCGGGCGCAGGGA
AAGGCAAAGATAATTGAGCGAGCCCTCAGCTAA
Gene >Ophun1|4268
ATGACGTCGGACCCCCTCGAAGATGTCCTTCACCTCGAGGACCGCTACTACCGCGAGGGCTACCAGCAAGGCCTC
GACGACGGCGCCAGAGCCGGACACGCCGAAGGCCGCACCTTTGGCCTGGAGAAGGGCCTCGAAAAGTTTCTCGAA
GGAGGTCGCCTGGCTGGAAGGGCTGTCGTCTGGGCCAATAGATTACCTCGTCGACAAGACGTCACGCCCGAAAAC
CTGCCTCATCGGAAGGACGACGACAAGCCAACAGTAGCGGACGCCAGCCAACCCAACTCCTCCTCTCGCCCCAAG
CGCTGTGAATTACCGCCGCTTCCCGAAAATACGCGCATCGAGAGAAACGTCAGGGCGCTCTACGCGCTCGTCGAG
CCGGGAACGCTCTCGACGGAAAACACGGACGAGGCGGTGCAGGATTTCGACAGCCGCATGAAGCGGGCGCAGGGA
AAGGCAAAGATAATTGAGCGAGCCCTCAGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail