Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4261
Gene name
LocationContig_393:10886..11460
Strand-
Gene length (bp)574
Transcript length (bp)435
Coding sequence length (bp)435
Protein length (aa) 145

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00436 SSB Single-strand binding protein family 4.9E-11 31 124

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32445|RIM1_YEAST Single-stranded DNA-binding protein RIM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM1 PE=1 SV=1 14 134 1.0E-11

GO

GO Term Description Terminal node
GO:0003697 single-stranded DNA binding Yes
GO:0003677 DNA binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6204
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2855
Ophiocordyceps australis map64 (Brazil) OphauB2|182
Ophiocordyceps camponoti-rufipedis Ophun1|4261 (this protein)
Ophiocordyceps kimflemingae Ophio5|660
Ophiocordyceps subramaniannii Hirsu2|631

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4261
MASFILRRSAAVTMPSAARGFSSTAARDLAKINIIGKVLNSPVASTTNSGRGLVKYTVLSQTHETKPASHFRVTV
FADGPRRDQLMNLAKGTLVYVEADASMSTYLDNDGRKQATLGILQRAMTILRKPEEMEEDNKSSKKTEE*
Coding >Ophun1|4261
ATGGCGTCCTTCATACTCCGCCGCTCGGCTGCCGTGACAATGCCGTCAGCCGCCCGAGGCTTCAGCTCCACGGCG
GCCCGTGATTTGGCCAAGATAAACATCATTGGCAAGGTCCTCAACTCGCCGGTTGCGAGTACGACCAACAGTGGC
CGCGGGCTCGTCAAGTACACCGTTCTTTCGCAGACACATGAAACCAAGCCCGCAAGCCACTTCCGCGTCACTGTC
TTTGCAGATGGTCCGCGGCGCGATCAATTGATGAACCTGGCCAAAGGGACCTTGGTCTACGTCGAGGCCGACGCC
TCCATGTCTACGTATCTTGATAACGACGGCCGGAAACAGGCCACCCTGGGCATTCTTCAGCGCGCCATGACCATC
CTCCGGAAACCGGAAGAGATGGAGGAAGACAACAAATCATCCAAGAAGACAGAGGAGTAG
Transcript >Ophun1|4261
ATGGCGTCCTTCATACTCCGCCGCTCGGCTGCCGTGACAATGCCGTCAGCCGCCCGAGGCTTCAGCTCCACGGCG
GCCCGTGATTTGGCCAAGATAAACATCATTGGCAAGGTCCTCAACTCGCCGGTTGCGAGTACGACCAACAGTGGC
CGCGGGCTCGTCAAGTACACCGTTCTTTCGCAGACACATGAAACCAAGCCCGCAAGCCACTTCCGCGTCACTGTC
TTTGCAGATGGTCCGCGGCGCGATCAATTGATGAACCTGGCCAAAGGGACCTTGGTCTACGTCGAGGCCGACGCC
TCCATGTCTACGTATCTTGATAACGACGGCCGGAAACAGGCCACCCTGGGCATTCTTCAGCGCGCCATGACCATC
CTCCGGAAACCGGAAGAGATGGAGGAAGACAACAAATCATCCAAGAAGACAGAGGAGTAG
Gene >Ophun1|4261
ATGGCGTCCTTCATACTCCGCCGCTCGGCTGCCGTGACAATGCCGTCAGCCGCCCGAGGCTTCAGCTCCACGGCG
GCCCGTGATTTGGCCAAGATAAACATCATTGGCAAGGTCCTCAACTCGCCGGTTGCGAGTACGACCAACAGTGGC
CGCGGGCTCGTCAAGTACACCGTTCTTTCGCAGACACATGAAACCAAGCCCGCAAGCCACTTCCGCGTCACTGTC
TTTGCAGATGGTCCGCGGCGCGATCAATTGATGAACCTGGCCAAAGGGTGCGTTCTTCATCGAGGACCAACCGTC
CTAACCCTTTGCCCAAGCTCTGGAACTGACCTTTGCTCGCAGGACCTTGGTCTACGTCGAGGCCGACGCCTCCAT
GTCTACGTATCTTGATAACGACGGCCGGAAACAGGCCACCCTGGGCATTCTTCAGCGTATGCAATCCATCTCACT
CCTTTCGGCCTTGTCTTTGTTGCGTGCTTGGTTGCTGATACCCTATGCAGGCGCCATGACCATCCTCCGGAAACC
GGAAGAGATGGAGGAAGACAACAAATCATCCAAGAAGACAGAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail