Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4255
Gene name
LocationContig_392:7200..9039
Strand-
Gene length (bp)1839
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 6.6E-10 6 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87175|APN2_SCHPO DNA-(apurinic or apyrimidinic site) lyase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apn2 PE=1 SV=1 1 304 3.0E-55
sp|Q9UBZ4|APEX2_HUMAN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Homo sapiens GN=APEX2 PE=1 SV=1 1 562 1.0E-43
sp|P38207|APN2_YEAST DNA-(apurinic or apyrimidinic site) lyase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APN2 PE=1 SV=1 1 313 4.0E-40
sp|Q5E9N9|APEX2_BOVIN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Bos taurus GN=APEX2 PE=2 SV=1 1 303 4.0E-34
sp|Q68G58|APEX2_MOUSE DNA-(apurinic or apyrimidinic site) lyase 2 OS=Mus musculus GN=Apex2 PE=1 SV=1 1 303 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87175|APN2_SCHPO DNA-(apurinic or apyrimidinic site) lyase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apn2 PE=1 SV=1 1 304 3.0E-55
sp|Q9UBZ4|APEX2_HUMAN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Homo sapiens GN=APEX2 PE=1 SV=1 1 562 1.0E-43
sp|P38207|APN2_YEAST DNA-(apurinic or apyrimidinic site) lyase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APN2 PE=1 SV=1 1 313 4.0E-40
sp|Q5E9N9|APEX2_BOVIN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Bos taurus GN=APEX2 PE=2 SV=1 1 303 4.0E-34
sp|Q68G58|APEX2_MOUSE DNA-(apurinic or apyrimidinic site) lyase 2 OS=Mus musculus GN=Apex2 PE=1 SV=1 1 303 5.0E-26
sp|F4JNY0|APE2_ARATH DNA-(apurinic or apyrimidinic site) lyase 2 OS=Arabidopsis thaliana GN=APE2 PE=1 SV=1 1 304 2.0E-23
sp|P28352|APEX1_MOUSE DNA-(apurinic or apyrimidinic site) lyase OS=Mus musculus GN=Apex1 PE=1 SV=2 8 298 6.0E-18
sp|P37454|EXOA_BACSU Exodeoxyribonuclease OS=Bacillus subtilis (strain 168) GN=exoA PE=1 SV=1 6 303 1.0E-17
sp|P43138|APEX1_RAT DNA-(apurinic or apyrimidinic site) lyase OS=Rattus norvegicus GN=Apex1 PE=1 SV=2 8 298 1.0E-17
sp|A2T7I6|APEX1_PONPY DNA-(apurinic or apyrimidinic site) lyase OS=Pongo pygmaeus GN=APEX1 PE=3 SV=1 8 298 2.0E-17
sp|A1YES6|APEX1_GORGO DNA-(apurinic or apyrimidinic site) lyase OS=Gorilla gorilla gorilla GN=APEX1 PE=3 SV=1 8 298 2.0E-17
sp|A2T6Y4|APEX1_PANTR DNA-(apurinic or apyrimidinic site) lyase OS=Pan troglodytes GN=APEX1 PE=3 SV=1 8 298 2.0E-17
sp|A1YFZ3|APEX1_PANPA DNA-(apurinic or apyrimidinic site) lyase OS=Pan paniscus GN=APEX1 PE=3 SV=1 8 298 2.0E-17
sp|P27695|APEX1_HUMAN DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens GN=APEX1 PE=1 SV=2 8 298 8.0E-17
sp|P23196|APEX1_BOVIN DNA-(apurinic or apyrimidinic site) lyase OS=Bos taurus GN=APEX1 PE=1 SV=2 8 298 9.0E-16
sp|A0MTA1|APEX1_DANRE DNA-(apurinic or apyrimidinic site) lyase OS=Danio rerio GN=apex1 PE=1 SV=1 8 298 5.0E-15
sp|P27864|RRP1_DROME Recombination repair protein 1 OS=Drosophila melanogaster GN=Rrp1 PE=1 SV=2 1 298 1.0E-14
sp|P45951|ARP_ARATH DNA-(apurinic or apyrimidinic site) lyase, chloroplastic OS=Arabidopsis thaliana GN=ARP PE=1 SV=2 8 298 3.0E-13
sp|P51173|APEA_DICDI DNA-(apurinic or apyrimidinic site) lyase OS=Dictyostelium discoideum GN=apeA PE=2 SV=2 105 298 4.0E-11
sp|P87175|APN2_SCHPO DNA-(apurinic or apyrimidinic site) lyase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apn2 PE=1 SV=1 491 569 1.0E-10
sp|Q68G58|APEX2_MOUSE DNA-(apurinic or apyrimidinic site) lyase 2 OS=Mus musculus GN=Apex2 PE=1 SV=1 450 562 3.0E-08
sp|Q5E9N9|APEX2_BOVIN DNA-(apurinic or apyrimidinic site) lyase 2 OS=Bos taurus GN=APEX2 PE=2 SV=1 437 562 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1949
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7284
Ophiocordyceps australis map64 (Brazil) OphauB2|5068
Ophiocordyceps camponoti-floridani Ophcf2|06137
Ophiocordyceps camponoti-rufipedis Ophun1|4255 (this protein)
Ophiocordyceps kimflemingae Ophio5|3763
Ophiocordyceps subramaniannii Hirsu2|2092

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4255
MFDTLEADIVVMQETKIQRKDLQDDMVLVPGWDVYFSLPRHKKGTPIAPSPPFPCYSGVAIYTRNSSCAPIRAEE
GVTGVLCPPKSEAKTYRHLPEHQQIGGYPRPGQLSGNVDELELDSEGRCVVLEFPAFVLLGVYSPASRNEARNDF
RLGFLNALDVRVRNLVAAGKQVVLVGDLNVIRSEKDTTNLMEALRKEDMTLQDWLSMPSRRLFNQLVFEGSVFGP
RDADRESPVLWDLCRCFHPARDGMNTCWETKRNMRPANNGSRIDYVLCSDGLKSWFEDANIQEGLMGSDHCPVFA
TISDRVHVGQEELVVADLMNPPGMFRDGRRVRDWCQKDVLPLSAKLIAEFDRRQSIRDMFSRVPSSSASSQLKPS
LESASKVAEMPCWSSEAALKSSVEAEAIAAASPSVDSSSVRDHHQLSQPKRSLAAETTGRASKRTKPASDPSTSK
AKAGPAQKTLQGFFKPVASSAEKRREEPSPTAEMTGASERVVDAVQAKASWSKLLGKRHVPRCEHDEPCISLVTK
KAGVNFGRSFYICPRPLGPSGEKEKGSEWRCGTFIWSSDWGGSSST*
Coding >Ophun1|4255
ATGTTCGACACGCTGGAAGCAGACATTGTCGTCATGCAGGAAACCAAGATACAGCGCAAAGATCTTCAGGATGAC
ATGGTTCTCGTCCCGGGATGGGATGTTTACTTTAGTCTACCACGGCACAAGAAAGGCACGCCCATAGCGCCCTCT
CCCCCTTTCCCGTGCTACTCCGGCGTCGCCATCTACACACGCAACTCCAGCTGCGCGCCCATCCGTGCCGAAGAA
GGGGTGACGGGCGTGCTCTGCCCTCCCAAGTCCGAGGCCAAGACCTATCGTCACCTCCCCGAGCACCAGCAGATC
GGCGGCTATCCACGGCCAGGCCAGCTGTCTGGGAATGTCGACGAGCTGGAGCTCGACTCTGAAGGGCGCTGCGTC
GTGCTCGAGTTCCCGGCCTTTGTCCTCCTCGGCGTCTACAGTCCGGCCAGCCGCAACGAAGCTCGCAATGACTTT
CGGCTCGGCTTTCTCAACGCGCTTGACGTGCGGGTGCGCAATCTCGTCGCGGCTGGCAAGCAGGTTGTTCTCGTC
GGCGACCTCAACGTAATCCGCAGCGAGAAGGACACGACGAATCTGATGGAGGCGTTGCGGAAAGAGGACATGACG
CTGCAGGATTGGCTGTCGATGCCATCTCGACGCCTCTTTAACCAGCTCGTCTTTGAAGGTTCGGTCTTTGGTCCG
CGAGATGCAGACCGCGAGAGCCCCGTCTTGTGGGATCTGTGTCGATGCTTCCATCCGGCTCGAGACGGCATGAAC
ACCTGCTGGGAAACCAAGAGAAACATGCGGCCAGCCAACAACGGCAGTAGAATCGATTACGTGCTCTGCAGCGAC
GGTCTGAAGAGCTGGTTCGAAGACGCCAACATCCAGGAGGGTCTGATGGGCTCCGACCACTGCCCCGTCTTCGCC
ACCATTTCGGACAGAGTCCACGTCGGCCAGGAGGAGCTCGTCGTGGCCGATCTCATGAATCCGCCCGGCATGTTT
CGAGACGGCAGACGAGTTCGCGACTGGTGTCAGAAGGACGTTCTCCCTCTGTCTGCCAAGCTGATAGCCGAGTTT
GACCGCCGTCAGAGCATCCGCGACATGTTTTCCCGGGTTCCCTCCTCGAGCGCGTCCTCTCAGCTGAAGCCGTCG
CTCGAGTCTGCGTCCAAGGTGGCAGAGATGCCCTGTTGGTCGTCAGAGGCAGCTTTGAAGTCCAGCGTCGAAGCG
GAAGCCATCGCGGCTGCGTCTCCTAGTGTAGACTCTTCGTCAGTAAGAGATCATCACCAGCTCAGCCAGCCGAAG
CGGTCTCTAGCAGCAGAGACAACGGGGCGAGCATCGAAACGCACCAAGCCCGCCAGCGACCCGTCCACCAGCAAA
GCCAAAGCAGGCCCAGCGCAAAAGACGCTACAGGGCTTCTTCAAGCCCGTCGCCTCCAGCGCAGAGAAACGCAGA
GAGGAGCCCTCGCCAACAGCGGAGATGACAGGGGCCTCGGAGCGAGTCGTCGATGCCGTTCAGGCCAAGGCGTCG
TGGTCCAAGCTCCTGGGTAAGCGGCACGTCCCCCGCTGCGAACACGACGAGCCGTGCATCAGTCTGGTGACCAAG
AAGGCCGGTGTCAACTTTGGACGATCGTTTTACATCTGTCCCCGTCCGCTTGGGCCGTCTGGCGAGAAGGAGAAG
GGTTCTGAGTGGCGATGCGGCACGTTTATCTGGAGTAGCGACTGGGGCGGTTCTTCTTCGACGTGA
Transcript >Ophun1|4255
ATGTTCGACACGCTGGAAGCAGACATTGTCGTCATGCAGGAAACCAAGATACAGCGCAAAGATCTTCAGGATGAC
ATGGTTCTCGTCCCGGGATGGGATGTTTACTTTAGTCTACCACGGCACAAGAAAGGCACGCCCATAGCGCCCTCT
CCCCCTTTCCCGTGCTACTCCGGCGTCGCCATCTACACACGCAACTCCAGCTGCGCGCCCATCCGTGCCGAAGAA
GGGGTGACGGGCGTGCTCTGCCCTCCCAAGTCCGAGGCCAAGACCTATCGTCACCTCCCCGAGCACCAGCAGATC
GGCGGCTATCCACGGCCAGGCCAGCTGTCTGGGAATGTCGACGAGCTGGAGCTCGACTCTGAAGGGCGCTGCGTC
GTGCTCGAGTTCCCGGCCTTTGTCCTCCTCGGCGTCTACAGTCCGGCCAGCCGCAACGAAGCTCGCAATGACTTT
CGGCTCGGCTTTCTCAACGCGCTTGACGTGCGGGTGCGCAATCTCGTCGCGGCTGGCAAGCAGGTTGTTCTCGTC
GGCGACCTCAACGTAATCCGCAGCGAGAAGGACACGACGAATCTGATGGAGGCGTTGCGGAAAGAGGACATGACG
CTGCAGGATTGGCTGTCGATGCCATCTCGACGCCTCTTTAACCAGCTCGTCTTTGAAGGTTCGGTCTTTGGTCCG
CGAGATGCAGACCGCGAGAGCCCCGTCTTGTGGGATCTGTGTCGATGCTTCCATCCGGCTCGAGACGGCATGAAC
ACCTGCTGGGAAACCAAGAGAAACATGCGGCCAGCCAACAACGGCAGTAGAATCGATTACGTGCTCTGCAGCGAC
GGTCTGAAGAGCTGGTTCGAAGACGCCAACATCCAGGAGGGTCTGATGGGCTCCGACCACTGCCCCGTCTTCGCC
ACCATTTCGGACAGAGTCCACGTCGGCCAGGAGGAGCTCGTCGTGGCCGATCTCATGAATCCGCCCGGCATGTTT
CGAGACGGCAGACGAGTTCGCGACTGGTGTCAGAAGGACGTTCTCCCTCTGTCTGCCAAGCTGATAGCCGAGTTT
GACCGCCGTCAGAGCATCCGCGACATGTTTTCCCGGGTTCCCTCCTCGAGCGCGTCCTCTCAGCTGAAGCCGTCG
CTCGAGTCTGCGTCCAAGGTGGCAGAGATGCCCTGTTGGTCGTCAGAGGCAGCTTTGAAGTCCAGCGTCGAAGCG
GAAGCCATCGCGGCTGCGTCTCCTAGTGTAGACTCTTCGTCAGTAAGAGATCATCACCAGCTCAGCCAGCCGAAG
CGGTCTCTAGCAGCAGAGACAACGGGGCGAGCATCGAAACGCACCAAGCCCGCCAGCGACCCGTCCACCAGCAAA
GCCAAAGCAGGCCCAGCGCAAAAGACGCTACAGGGCTTCTTCAAGCCCGTCGCCTCCAGCGCAGAGAAACGCAGA
GAGGAGCCCTCGCCAACAGCGGAGATGACAGGGGCCTCGGAGCGAGTCGTCGATGCCGTTCAGGCCAAGGCGTCG
TGGTCCAAGCTCCTGGGTAAGCGGCACGTCCCCCGCTGCGAACACGACGAGCCGTGCATCAGTCTGGTGACCAAG
AAGGCCGGTGTCAACTTTGGACGATCGTTTTACATCTGTCCCCGTCCGCTTGGGCCGTCTGGCGAGAAGGAGAAG
GGTTCTGAGTGGCGATGCGGCACGTTTATCTGGAGTAGCGACTGGGGCGGTTCTTCTTCGACGTGA
Gene >Ophun1|4255
ATGTTCGACACGCTGGAAGCAGACATTGTCGTCATGCAGGAAACCAAGATACAGCGCAAAGATCTTCAGGATGAC
ATGGTTCTCGTCCCGGGATGGGATGTTTACTTTAGTCTACCACGGCACAAGAAAGGCACGCCCATAGCGCCCTCT
CCCCCTTTCCCGTGTCCGCGCCCGTATCCGTGGAGTGCTTCTTAGTTGACATGCCATCTCCTCTCTCCCTTCAGG
CTACTCCGGCGTCGCCATCTACACACGCAACTCCAGCTGCGCGCCCATCCGTGCCGAAGAAGGGGTGACGGGCGT
GCTCTGCCCTCCCAAGTCCGAGGCCAAGACCTATCGTCACCTCCCCGAGCACCAGCAGATCGGCGGCTATCCACG
GCCAGGCCAGCTGTCTGGGAATGTCGACGAGCTGGAGCTCGACTCTGAAGGGCGCTGCGTCGTGCTCGAGTTCCC
GGCCTTTGTCCTCCTCGGCGTCTACAGTCCGGCCAGCCGCAACGAAGCTCGCAATGACTTTCGGCTCGGCTTTCT
CAACGCGCTTGACGTGCGGGTGCGCAATCTCGTCGCGGCTGGCAAGCAGGTTGTTCTCGTCGGCGACCTCAACGT
AATCCGCAGCGAGAAGGACACGACGAATCTGATGGAGGCGTTGCGGAAAGAGGACATGACGCTGCAGGATTGGCT
GTCGATGCCATCTCGACGCCTCTTTAACCAGCTCGTCTTTGAAGGTTCGGTCTTTGGTCCGCGAGATGCAGACCG
CGAGAGCCCCGTCTTGTGGGATCTGTGTCGATGCTTCCATCCGGCTCGAGACGGCATGAACACCTGCTGGGAAAC
CAAGAGAAACATGCGGCCAGCCAACAACGGCAGTAGAATCGATTACGTGCTCTGCAGCGACGGTCTGAAGAGCTG
GTTCGAAGACGCCAACATCCAGGAGGGTCTGATGGGCTCCGACCACTGCCCCGTCTTCGCCACCATTTCGGACAG
AGTCCACGTCGGCCAGGAGGAGCTCGTCGTGGCCGATCTCATGAATCCGCCCGGCATGTTTCGAGACGGCAGACG
AGTTCGCGACTGGTGTCAGAAGGACGTTCTCCCTCTGTCTGCCAAGCTGATAGCCGAGTTTGACCGCCGTCAGAG
CATCCGCGACATGTTTTCCCGGGTTCCCTCCTCGAGCGCGTCCTCTCAGCTGAAGCCGTCGCTCGAGTCTGCGTC
CAAGGTGGCAGAGATGCCCTGTTGGTCGTCAGAGGCAGCTTTGAAGTCCAGCGTCGAAGCGGAAGCCATCGCGGC
TGCGTCTCCTAGTGTAGACTCTTCGTCAGTAAGAGATCATCACCAGCTCAGCCAGCCGAAGCGGTCTCTAGCAGC
AGAGACAACGGGGCGAGCATCGAAACGCACCAAGCCCGCCAGCGACCCGTCCACCAGCAAAGCCAAAGCAGGCCC
AGCGCAAAAGACGCTACAGGGCTTCTTCAAGCCCGTCGCCTCCAGCGCAGAGAAACGCAGAGAGGAGCCCTCGCC
AACAGCGGAGATGACAGGGGCCTCGGAGCGAGTCGTCGATGCCGTTCAGGCCAAGGCGTCGTGGTCCAAGCTCCT
GGGTAAGCGGCACGTCCCCCGCTGCGAACACGACGAGCCGTGCATCAGTCTGGTGACCAAGAAGGCCGGTGTCAA
CTTTGGTCAGTCGAGGGTCATGAGATGTGATGAGAAGGTTGATGAGAGAGCGAGGCTGACTTTGCAGGACGATCG
TTTTACATCTGTCCCCGTCCGCTTGGGCCGTCTGGCGAGAAGGAGAAGGGTTCTGAGTGGCGATGCGGCACGTTT
ATCTGGAGTAGCGACTGGGGCGGTTCTTCTTCGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail