Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4253
Gene name
LocationContig_392:2829..3614
Strand+
Gene length (bp)785
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 3.6E-20 128 195
PF09011 HMG_box_2 HMG-box domain 1.5E-06 126 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36981|MATB_NEUCS Mating-type protein a-1 OS=Neurospora crassa GN=mta-1 PE=1 SV=2 23 208 1.0E-25
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 9 204 2.0E-23
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 127 206 3.0E-18
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 127 206 3.0E-18
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 127 206 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36981|MATB_NEUCS Mating-type protein a-1 OS=Neurospora crassa GN=mta-1 PE=1 SV=2 23 208 1.0E-25
sp|P35693|FPR1_PODAS MAT+ sexual cell fertilization-promoting factor OS=Podospora anserina GN=FPR1 PE=3 SV=2 9 204 2.0E-23
sp|P0CY16|MTMC3_SCHPO Silenced mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat3-Mc PE=3 SV=1 127 206 3.0E-18
sp|P0CY17|MATMC_SCHPO Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mat1-Mc PE=2 SV=1 127 206 3.0E-18
sp|C7U331|MATMC_SCHPM Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces pombe GN=mat3-Mc PE=2 SV=1 127 206 3.0E-18
sp|Q6WRX6|MATMC_SCHKA Mating-type M-specific polypeptide Mc OS=Schizosaccharomyces kambucha GN=matMc PE=3 SV=1 127 206 4.0E-18
sp|Q8AWH3|SX17A_XENTR Transcription factor Sox-17-alpha OS=Xenopus tropicalis GN=sox17a PE=2 SV=1 125 212 5.0E-10
sp|P36631|STE11_SCHPO Transcription factor ste11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste11 PE=1 SV=2 113 210 6.0E-10
sp|O42601|S17B1_XENLA Transcription factor Sox-17-beta.1 OS=Xenopus laevis GN=sox17b.1 PE=1 SV=1 125 213 2.0E-09
sp|Q90ZH9|S17AB_XENLA Transcription factor Sox-17-alpha-B OS=Xenopus laevis GN=sox17a-b PE=1 SV=1 125 213 2.0E-09
sp|Q3KQ35|S17AA_XENLA Transcription factor Sox-17-alpha-A OS=Xenopus laevis GN=sox17a-a PE=1 SV=1 125 213 2.0E-09
sp|A5D8R3|S17B3_XENLA Transcription factor Sox-17-beta.3 OS=Xenopus laevis GN=sox17b.3 PE=2 SV=1 125 213 2.0E-09
sp|Q5A220|RFG1_CANAL Repressor of filamentous growth 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFG1 PE=2 SV=2 124 207 2.0E-09
sp|Q8AWH2|S17B1_XENTR Transcription factor Sox-17-beta.1 OS=Xenopus tropicalis GN=sox17b.1 PE=2 SV=1 125 213 3.0E-09
sp|Q6F2F0|S17B3_XENTR Transcription factor Sox-17-beta.3 OS=Xenopus tropicalis GN=sox17b.3 PE=3 SV=2 125 222 3.0E-09
sp|Q02991|MAT2_COCHE Mating-type protein MAT-2 OS=Cochliobolus heterostrophus GN=MAT2 PE=3 SV=1 127 204 8.0E-09
sp|Q9H6I2|SOX17_HUMAN Transcription factor SOX-17 OS=Homo sapiens GN=SOX17 PE=1 SV=1 125 210 1.0E-08
sp|Q9P445|MAT2_COCSA Mating-type protein MAT-2 OS=Cochliobolus sativus GN=MAT2 PE=3 SV=1 127 204 1.0E-08
sp|Q6GLH8|S17B2_XENTR Transcription factor Sox-17-beta.2 OS=Xenopus tropicalis GN=sox17b.2 PE=2 SV=2 125 210 1.0E-08
sp|Q61473|SOX17_MOUSE Transcription factor SOX-17 OS=Mus musculus GN=Sox17 PE=1 SV=1 125 210 1.0E-08
sp|P35713|SOX18_HUMAN Transcription factor SOX-18 OS=Homo sapiens GN=SOX18 PE=1 SV=2 125 210 2.0E-08
sp|Q90ZH7|SX18B_XENLA Transcription factor Sox-18B OS=Xenopus laevis GN=sox18-b PE=1 SV=1 123 212 2.0E-08
sp|Q864Q7|SRY_EUBAS Sex-determining region Y protein OS=Eubalaena australis GN=SRY PE=3 SV=1 102 205 2.0E-08
sp|P36393|SRY_PIG Sex-determining region Y protein OS=Sus scrofa GN=SRY PE=2 SV=3 127 205 2.0E-08
sp|B3DLD3|SOX18_XENTR Transcription factor Sox-18 OS=Xenopus tropicalis GN=sox18 PE=2 SV=1 123 212 2.0E-08
sp|P40657|SOX15_DROME Putative transcription factor SOX-15 OS=Drosophila melanogaster GN=Sox15 PE=2 SV=2 124 219 2.0E-08
sp|Q32PP9|SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio GN=sox14 PE=2 SV=1 128 201 3.0E-08
sp|B0ZTE2|SOX14_XENLA Transcription factor Sox-14 OS=Xenopus laevis GN=sox14 PE=2 SV=1 128 201 3.0E-08
sp|A4QNG3|SOX14_XENTR Transcription factor Sox-14 OS=Xenopus tropicalis GN=sox14 PE=2 SV=1 128 201 3.0E-08
sp|P61259|SOX14_MACFA Transcription factor SOX-14 OS=Macaca fascicularis GN=SOX14 PE=2 SV=1 128 201 4.0E-08
sp|O95416|SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens GN=SOX14 PE=1 SV=1 128 201 4.0E-08
sp|Q9W7R6|SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus GN=SOX14 PE=2 SV=1 128 201 4.0E-08
sp|Q04892|SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus GN=Sox14 PE=2 SV=2 128 201 4.0E-08
sp|P43680|SOX18_MOUSE Transcription factor SOX-18 OS=Mus musculus GN=Sox18 PE=1 SV=3 127 210 4.0E-08
sp|Q6DGL6|SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio GN=sox1a PE=2 SV=2 127 201 5.0E-08
sp|P36396|SRY_URSAR Sex-determining region Y protein OS=Ursus arctos GN=SRY PE=3 SV=2 103 203 5.0E-08
sp|Q68FA4|SOX3_XENTR Transcription factor Sox-3 OS=Xenopus tropicalis GN=sox3 PE=2 SV=1 122 201 5.0E-08
sp|Q6P0E1|SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio GN=sox2 PE=2 SV=1 127 201 5.0E-08
sp|Q2Z1R2|SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio GN=sox1b PE=2 SV=1 127 201 6.0E-08
sp|Q2PG84|SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis GN=sox1 PE=2 SV=1 127 201 7.0E-08
sp|Q864Q9|SRY_BALPH Sex-determining region Y protein OS=Balaenoptera physalus GN=SRY PE=3 SV=1 102 205 7.0E-08
sp|Q864Q8|SRY_MEGNO Sex-determining region Y protein OS=Megaptera novaeangliae GN=SRY PE=3 SV=1 102 205 7.0E-08
sp|Q864R0|SRY_BALMU Sex-determining region Y protein OS=Balaenoptera musculus GN=SRY PE=3 SV=1 102 205 8.0E-08
sp|Q863D9|SRY_ALCAC Sex-determining region Y protein OS=Alces alces cameloides GN=SRY PE=3 SV=1 128 208 8.0E-08
sp|A2TED3|SOX1_XENTR Transcription factor Sox-1 OS=Xenopus tropicalis GN=sox1 PE=2 SV=1 127 201 8.0E-08
sp|Q864R1|SRY_BALBN Sex-determining region Y protein OS=Balaenoptera bonaerensis GN=SRY PE=3 SV=1 102 205 8.0E-08
sp|Q864R2|SRY_BALAC Sex-determining region Y protein OS=Balaenoptera acutorostrata GN=SRY PE=3 SV=1 102 205 8.0E-08
sp|Q864Q4|SRY_MESST Sex-determining region Y protein OS=Mesoplodon stejnegeri GN=SRY PE=3 SV=1 102 205 8.0E-08
sp|O42342|SOX7_XENLA Transcription factor Sox-7 OS=Xenopus laevis GN=sox7 PE=2 SV=1 124 207 9.0E-08
sp|P48430|SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus GN=SOX2 PE=1 SV=1 127 201 9.0E-08
sp|O57401|SOX1_CHICK Transcription factor SOX-1 OS=Gallus gallus GN=SOX1 PE=2 SV=1 127 201 9.0E-08
sp|O42569|SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis GN=sox2 PE=2 SV=1 127 201 9.0E-08
sp|Q08143|SMR2_PODAS Sporulation minus regulator 2 OS=Podospora anserina GN=SMR2 PE=3 SV=1 122 208 9.0E-08
sp|Q28GD5|SOX7_XENTR Transcription factor Sox-7 OS=Xenopus tropicalis GN=sox7 PE=2 SV=1 124 207 9.0E-08
sp|P53783|SOX1_MOUSE Transcription factor SOX-1 OS=Mus musculus GN=Sox1 PE=2 SV=2 127 201 9.0E-08
sp|O00570|SOX1_HUMAN Transcription factor SOX-1 OS=Homo sapiens GN=SOX1 PE=1 SV=2 127 201 9.0E-08
sp|Q6NVN0|SOX2_XENTR Transcription factor Sox-2 OS=Xenopus tropicalis GN=sox2 PE=2 SV=1 127 201 1.0E-07
sp|P40646|SOX7_MOUSE Transcription factor SOX-7 OS=Mus musculus GN=Sox7 PE=1 SV=2 124 213 1.0E-07
sp|Q90ZH8|SX18A_XENLA Transcription factor Sox-18A OS=Xenopus laevis GN=sox18-a PE=1 SV=1 127 212 1.0E-07
sp|P48432|SOX2_MOUSE Transcription factor SOX-2 OS=Mus musculus GN=Sox2 PE=1 SV=2 127 201 1.0E-07
sp|P48431|SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens GN=SOX2 PE=1 SV=1 127 201 1.0E-07
sp|P54231|SOX2_SHEEP Transcription factor SOX-2 OS=Ovis aries GN=SOX2 PE=3 SV=1 127 201 1.0E-07
sp|Q24533|DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster GN=D PE=2 SV=1 124 201 1.0E-07
sp|Q864Q3|SRY_DELLE Sex-determining region Y protein OS=Delphinapterus leucas GN=SRY PE=3 SV=1 102 201 2.0E-07
sp|Q6TC28|SRY_LUTLU Sex-determining region Y protein OS=Lutra lutra GN=SRY PE=3 SV=1 91 201 2.0E-07
sp|Q9BT81|SOX7_HUMAN Transcription factor SOX-7 OS=Homo sapiens GN=SOX7 PE=1 SV=1 124 213 2.0E-07
sp|Q5FWM3|SOX3B_XENLA Transcription factor Sox-3-B OS=Xenopus laevis GN=sox3-b PE=2 SV=1 123 201 2.0E-07
sp|Q864Q2|SRY_PHOPH Sex-determining region Y protein OS=Phocoena phocoena GN=SRY PE=3 SV=1 102 201 2.0E-07
sp|Q864Q1|SRY_NEOPH Sex-determining region Y protein OS=Neophocaena phocaenoides GN=SRY PE=3 SV=1 102 201 2.0E-07
sp|Q6TC27|SRY_ENHLU Sex-determining region Y protein OS=Enhydra lutris GN=SRY PE=3 SV=1 91 201 2.0E-07
sp|Q864P7|SRY_GRAGR Sex-determining region Y protein OS=Grampus griseus GN=SRY PE=3 SV=1 93 201 2.0E-07
sp|Q9W7R5|SOX21_CHICK Transcription factor SOX-21 OS=Gallus gallus GN=SOX21 PE=2 SV=1 130 201 2.0E-07
sp|Q864Q0|SRY_TURTR Sex-determining region Y protein OS=Tursiops truncatus GN=SRY PE=3 SV=1 93 201 2.0E-07
sp|Q864P6|SRY_PENEL Sex-determining region Y protein OS=Peponocephala electra GN=SRY PE=3 SV=1 93 201 2.0E-07
sp|Q864P8|SRY_LAGOL Sex-determining region Y protein OS=Lagenorhynchus obliquidens GN=SRY PE=3 SV=1 93 201 2.0E-07
sp|Q864P4|SRY_GLOMA Sex-determining region Y protein OS=Globicephala macrorhynchus GN=SRY PE=3 SV=2 93 201 2.0E-07
sp|Q864P9|SRY_DELDE Sex-determining region Y protein OS=Delphinus delphis GN=SRY PE=3 SV=1 93 201 2.0E-07
sp|Q6RVD7|SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio GN=sox21b PE=2 SV=1 128 201 2.0E-07
sp|Q864P3|SRY_ORCBR Sex-determining region Y protein OS=Orcaella brevirostris GN=SRY PE=3 SV=1 93 201 3.0E-07
sp|Q864Q5|SRY_KOGSI Sex-determining region Y protein OS=Kogia sima GN=SRY PE=3 SV=1 102 205 3.0E-07
sp|Q811W0|SOX21_MOUSE Transcription factor SOX-21 OS=Mus musculus GN=Sox21 PE=2 SV=1 128 201 3.0E-07
sp|Q9Y651|SOX21_HUMAN Transcription factor SOX-21 OS=Homo sapiens GN=SOX21 PE=2 SV=1 128 201 3.0E-07
sp|B0ZTE1|SOX21_XENLA Transcription factor Sox-21 OS=Xenopus laevis GN=sox21 PE=2 SV=1 128 201 3.0E-07
sp|P36389|SRY_HORSE Sex-determining region Y protein OS=Equus caballus GN=SRY PE=2 SV=2 127 201 3.0E-07
sp|Q6EJB7|SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio GN=sox3 PE=1 SV=1 127 201 3.0E-07
sp|Q7SZS1|SX21A_DANRE Transcription factor Sox-21-A OS=Danio rerio GN=sox21a PE=2 SV=1 128 201 5.0E-07
sp|Q9U1H0|CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster GN=cic PE=1 SV=2 123 223 5.0E-07
sp|P48433|SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus GN=SOX3 PE=2 SV=1 127 201 6.0E-07
sp|Q67EX7|SRY_MOSBE Sex-determining region Y protein OS=Moschus berezovskii GN=SRY PE=3 SV=1 128 205 6.0E-07
sp|Q863B7|SRY_ELADA Sex-determining region Y protein OS=Elaphurus davidianus GN=SRY PE=3 SV=1 128 208 6.0E-07
sp|Q9BH08|SRY_CERNI Sex-determining region Y protein OS=Cervus nippon GN=SRY PE=3 SV=1 128 208 6.0E-07
sp|Q863C2|SRY_AXIPR Sex-determining region Y protein OS=Axis porcinus GN=SRY PE=3 SV=1 128 208 7.0E-07
sp|Q9DDD7|SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio GN=sox19b PE=1 SV=1 108 211 8.0E-07
sp|Q69FB1|SRY_BUBBU Sex-determining region Y protein OS=Bubalus bubalis GN=SRY PE=3 SV=1 128 205 8.0E-07
sp|P55863|SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis GN=sox3-a PE=1 SV=1 127 201 9.0E-07
sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=1 SV=3 127 201 1.0E-06
sp|Q6TC46|SRY_EUMJU Sex-determining region Y protein OS=Eumetopias jubatus GN=SRY PE=3 SV=1 127 203 1.0E-06
sp|Q04886|SOX8_MOUSE Transcription factor SOX-8 OS=Mus musculus GN=Sox8 PE=2 SV=2 122 217 1.0E-06
sp|Q6TC44|SRY_ARCGZ Sex-determining region Y protein OS=Arctocephalus gazella GN=SRY PE=3 SV=1 127 203 1.0E-06
sp|Q6T724|SRY_ARCFO Sex-determining region Y protein OS=Arctocephalus forsteri GN=SRY PE=3 SV=1 127 203 1.0E-06
sp|Q6T723|SRY_ARCAU Sex-determining region Y protein OS=Arctocephalus australis GN=SRY PE=3 SV=1 127 203 1.0E-06
sp|Q8SPQ1|SRY_BOSJA Sex-determining region Y protein OS=Bos javanicus GN=SRY PE=3 SV=1 128 205 1.0E-06
sp|Q6TC45|SRY_ZALCA Sex-determining region Y protein OS=Zalophus californianus GN=SRY PE=3 SV=1 127 201 1.0E-06
sp|Q6TC30|SRY_ERIBA Sex-determining region Y protein OS=Erignathus barbatus GN=SRY PE=3 SV=1 127 203 1.0E-06
sp|Q03256|SRY_CAPHI Sex-determining region Y protein OS=Capra hircus GN=SRY PE=3 SV=2 128 205 1.0E-06
sp|Q6TC43|SRY_CALUR Sex-determining region Y protein OS=Callorhinus ursinus GN=SRY PE=3 SV=1 127 203 1.0E-06
sp|Q6TC40|SRY_HYDLE Sex-determining region Y protein OS=Hydrurga leptonyx GN=SRY PE=3 SV=1 127 203 2.0E-06
sp|Q6TC37|SRY_CYSCR Sex-determining region Y protein OS=Cystophora cristata GN=SRY PE=3 SV=1 127 203 2.0E-06
sp|Q864Q6|SRY_PHYCD Sex-determining region Y protein OS=Physeter catodon GN=SRY PE=3 SV=1 102 205 2.0E-06
sp|Q864P5|SRY_ORCOR Sex-determining region Y protein OS=Orcinus orca GN=SRY PE=3 SV=1 103 201 2.0E-06
sp|Q03257|SRY_SHEEP Sex-determining region Y protein OS=Ovis aries GN=SRY PE=3 SV=2 128 205 2.0E-06
sp|P36390|SRY_HALGR Sex-determining region Y protein OS=Halichoerus grypus GN=SRY PE=3 SV=2 127 201 2.0E-06
sp|Q6TC39|SRY_MIRAN Sex-determining region Y protein OS=Mirounga angustirostris GN=SRY PE=3 SV=1 127 201 2.0E-06
sp|Q6TC36|SRY_PAGGO Sex-determining region Y protein OS=Pagophilus groenlandicus GN=SRY PE=3 SV=1 127 203 2.0E-06
sp|Q6TC32|SRY_PUSHI Sex-determining region Y protein OS=Pusa hispida GN=SRY PE=3 SV=1 127 201 2.0E-06
sp|Q6TC33|SRY_PHOVI Sex-determining region Y protein OS=Phoca vitulina GN=SRY PE=3 SV=1 127 201 2.0E-06
sp|Q6TC31|SRY_PHOLR Sex-determining region Y protein OS=Phoca largha GN=SRY PE=3 SV=1 127 201 2.0E-06
sp|Q6TC34|SRY_PUSCA Sex-determining region Y protein OS=Pusa caspica GN=SRY PE=3 SV=1 127 201 2.0E-06
sp|Q6TC38|SRY_MIRLE Sex-determining region Y protein OS=Mirounga leonina GN=SRY PE=3 SV=1 127 201 3.0E-06
sp|P47792|SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio GN=sox19a PE=1 SV=2 127 201 3.0E-06
sp|Q870J1|STE11_PNECA HMG-box protein STE11 OS=Pneumocystis carinii PE=1 SV=1 131 216 3.0E-06
sp|Q9BG90|SRY_MACMU Sex-determining region Y protein OS=Macaca mulatta GN=SRY PE=2 SV=1 127 204 3.0E-06
sp|O60248|SOX15_HUMAN Protein SOX-15 OS=Homo sapiens GN=SOX15 PE=1 SV=1 127 201 4.0E-06
sp|Q9XT60|SRY_CANLF Sex-determining region Y protein OS=Canis lupus familiaris GN=SRY PE=3 SV=1 127 201 4.0E-06
sp|P41225|SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens GN=SOX3 PE=1 SV=2 127 201 5.0E-06
sp|Q28778|SRY_PANPA Sex-determining region Y protein OS=Pan paniscus GN=SRY PE=3 SV=1 127 203 5.0E-06
sp|P57074|SOX8_CHICK Transcription factor SOX-8 OS=Gallus gallus GN=SOX8 PE=2 SV=1 122 217 5.0E-06
sp|Q6VVD7|SOX8_XENLA Transcription factor Sox-8 OS=Xenopus laevis GN=sox8 PE=2 SV=1 122 217 5.0E-06
sp|P36394|SRY_RAT Sex-determining region Y protein (Fragment) OS=Rattus norvegicus GN=Sry PE=1 SV=2 125 201 5.0E-06
sp|P51501|SRY_CALJA Sex-determining region Y protein OS=Callithrix jacchus GN=SRY PE=3 SV=1 127 203 5.0E-06
sp|P57073|SOX8_HUMAN Transcription factor SOX-8 OS=Homo sapiens GN=SOX8 PE=2 SV=1 122 217 6.0E-06
sp|P53784|SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus GN=Sox3 PE=1 SV=2 127 201 6.0E-06
sp|Q23045|EGL13_CAEEL Transcription factor egl-13 OS=Caenorhabditis elegans GN=egl-13 PE=1 SV=2 128 200 6.0E-06
sp|Q8SPQ2|SRY_BISBI Sex-determining region Y protein OS=Bison bison GN=SRY PE=3 SV=1 128 205 8.0E-06
sp|Q7JGF7|SRY_BOSIN Sex-determining region Y protein OS=Bos indicus GN=SRY PE=3 SV=1 128 205 8.0E-06
sp|Q7JGF9|SRY_BOSGF Sex-determining region Y protein OS=Bos gaurus frontalis GN=SRY PE=3 SV=1 128 205 8.0E-06
sp|Q27949|SRY_BISBO Sex-determining region Y protein OS=Bison bonasus GN=SRY PE=3 SV=2 128 205 8.0E-06
sp|Q05066|SRY_HUMAN Sex-determining region Y protein OS=Homo sapiens GN=SRY PE=1 SV=1 127 204 8.0E-06
sp|P48046|SRY_GORGO Sex-determining region Y protein OS=Gorilla gorilla gorilla GN=SRY PE=3 SV=1 127 204 8.0E-06
sp|Q03255|SRY_BOVIN Sex-determining region Y protein OS=Bos taurus GN=SRY PE=3 SV=2 128 205 8.0E-06
sp|Q6TC41|SRY_MONSC Sex-determining region Y protein OS=Monachus schauinslandi GN=SRY PE=3 SV=1 127 200 8.0E-06
sp|Q28783|SRY_PONPY Sex-determining region Y protein OS=Pongo pygmaeus GN=SRY PE=3 SV=1 127 204 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1950
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5278
Ophiocordyceps australis map64 (Brazil) OphauB2|5041
Ophiocordyceps australis map64 (Brazil) OphauB2|5042
Ophiocordyceps camponoti-rufipedis Ophun1|4253 (this protein)
Ophiocordyceps kimflemingae Ophio5|3762
Ophiocordyceps subramaniannii Hirsu2|2094

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4253
MDIPSNINNPGGLVTTPYNRQLWNRLQDQVHPFSQVLSIEGEIYRKLSPATKQYIAKKFMNHVQENVIFVVDGNG
PDRAYLGAPRHFTTGGGMVIYPSGRDLFWIRRGQSNVMTATLMVPPLPKKAKIPRPPNAYILYRKERHHMVKNAN
PGITNNEISQLLGKAWNIESAEIRAKYKKMSDDIKEALMKKHPDYQYRPRRAGERRRRRRNDDQDEETPTANA*
Coding >Ophun1|4253
ATGGATATTCCTTCGAACATCAACAATCCAGGCGGCTTGGTGACTACTCCCTACAATCGACAGCTTTGGAACCGC
CTCCAGGACCAGGTCCACCCTTTCTCGCAGGTCCTCTCCATCGAAGGAGAAATCTATCGCAAGCTTTCCCCGGCT
ACCAAGCAGTACATTGCCAAGAAGTTCATGAATCATGTTCAGGAGAATGTGATTTTTGTCGTGGACGGCAACGGC
CCTGATCGTGCCTACCTCGGAGCTCCTCGCCACTTCACCACTGGCGGGGGCATGGTCATTTATCCTTCGGGACGT
GATCTTTTCTGGATTCGACGCGGCCAGTCGAATGTTATGACGGCTACCTTGATGGTGCCTCCTCTGCCCAAGAAA
GCGAAAATTCCTCGCCCTCCCAATGCGTACATTCTGTATCGCAAGGAGCGCCACCACATGGTCAAAAATGCAAAC
CCCGGTATTACCAACAATGAAATTTCTCAGCTTCTGGGTAAAGCTTGGAATATCGAGTCGGCTGAAATCAGAGCG
AAGTACAAGAAAATGTCGGATGATATCAAGGAAGCTTTAATGAAGAAGCATCCCGACTACCAGTACCGCCCTCGC
CGCGCTGGTGAGCGTCGCCGCCGCCGTCGCAATGACGACCAGGACGAGGAAACTCCTACTGCAAATGCTTAA
Transcript >Ophun1|4253
ATGGATATTCCTTCGAACATCAACAATCCAGGCGGCTTGGTGACTACTCCCTACAATCGACAGCTTTGGAACCGC
CTCCAGGACCAGGTCCACCCTTTCTCGCAGGTCCTCTCCATCGAAGGAGAAATCTATCGCAAGCTTTCCCCGGCT
ACCAAGCAGTACATTGCCAAGAAGTTCATGAATCATGTTCAGGAGAATGTGATTTTTGTCGTGGACGGCAACGGC
CCTGATCGTGCCTACCTCGGAGCTCCTCGCCACTTCACCACTGGCGGGGGCATGGTCATTTATCCTTCGGGACGT
GATCTTTTCTGGATTCGACGCGGCCAGTCGAATGTTATGACGGCTACCTTGATGGTGCCTCCTCTGCCCAAGAAA
GCGAAAATTCCTCGCCCTCCCAATGCGTACATTCTGTATCGCAAGGAGCGCCACCACATGGTCAAAAATGCAAAC
CCCGGTATTACCAACAATGAAATTTCTCAGCTTCTGGGTAAAGCTTGGAATATCGAGTCGGCTGAAATCAGAGCG
AAGTACAAGAAAATGTCGGATGATATCAAGGAAGCTTTAATGAAGAAGCATCCCGACTACCAGTACCGCCCTCGC
CGCGCTGGTGAGCGTCGCCGCCGCCGTCGCAATGACGACCAGGACGAGGAAACTCCTACTGCAAATGCTTAA
Gene >Ophun1|4253
ATGGATATTCCTTCGAACATCAACAATCCAGGCGGCTTGGTGACTACTCCCTACAATCGACAGCTTTGGAACCGC
CTCCAGGACCAGGTCCACCCTTTCTCGCAGGTCCTCTCCATCGAAGGAGAAATCTATCGCAAGCTTTCCCCGGCT
ACCAAGCAGTACATTGCCAAGAAGTTCATGTGAGTTTTGTTTCTACCTCACGGTGATTATCTTTTCTAACGGCGC
GCAGGAATCATGTTCAGGAGAATGTGATTTTTGTCGTGGACGGCAACGGCCCTGATCGTGCCTACCTCGGAGCTC
CTCGCCACTTCACCACTGGCGGGGGCATGGTCATTTATCCTTCGGGACGTGATCTTTTCTGGATTCGACGCGGCC
AGTCGAATGTTATGACGGCTACCTTGATGGTGCCTCCTCTGCCCAAGAAAGCGAAAATTCCTCGCCCTCCCAATG
CGTACATTCTGTATCGCAAGGAGCGCCACCACATGGTCAAAAATGCAAACCCCGGTATTACCAACAATGAAATTT
GTGAGTCAAACATGATCATCTTCATTATTTTCCGCGTGAAACATTTGCTAACAAAAAATTCAGCTCAGCTTCTGG
GTAAAGCTTGGAATATCGAGTCGGCTGAAATCAGAGCGAAGTACAAGAAAATGTCGGATGATATCAAGGAAGCTT
TAATGAAGAAGCATCCCGACTACCAGTACCGCCCTCGCCGCGCTGGTGAGCGTCGCCGCCGCCGTCGCAATGACG
ACCAGGACGAGGAAACTCCTACTGCAAATGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail