Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|425
Gene name
LocationContig_112:3819..4730
Strand-
Gene length (bp)911
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 4.3E-15 66 264

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23903|E13B_BACCI Glucan endo-1,3-beta-glucosidase A1 OS=Bacillus circulans GN=glcA PE=1 SV=1 23 281 6.0E-17
sp|P45798|GUB_RHOMR Beta-glucanase OS=Rhodothermus marinus GN=bglA PE=1 SV=1 31 281 2.0E-16
sp|Q9ZG90|KSBGL_SPHMU Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum PE=1 SV=1 111 281 7.0E-07

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|425
MISYRTLAALYYFLSAVSAWGAPNYGGFGRVWQETFSGPAGSSPNRGNWNIIEGNLGYNEELQRYTASNSNLQLT
GGDTLQIIPRRDGGGWTSGRLESTYVARPSAGKVTKLEAVIRFGGNGVDRKKGIWPAFWVLGDSHRHGTPWPACG
ELDIMETVNGQLTGYGTVHCDVFPGGICNEGNGIGAGTGFPDQGWHTWSLEIDRRPGNWQDQSITWFIDGRQFHQ
VKGYRINKFDVWASLTDRPLYFILNLAVGGKWPGPPDGNTLDSFGSMMEVGYVAHYST*
Coding >Ophun1|425
ATGATCTCCTATCGAACGTTGGCCGCTCTCTATTACTTCCTGTCCGCCGTTTCCGCTTGGGGAGCTCCCAACTAT
GGCGGCTTCGGGCGTGTCTGGCAGGAGACCTTCTCGGGGCCGGCCGGCTCGAGTCCGAACCGGGGCAACTGGAAC
ATCATCGAGGGCAACTTGGGATACAACGAAGAGCTGCAGAGATACACGGCCTCCAACAGCAACCTGCAGCTCACC
GGCGGCGATACGTTGCAGATCATCCCCAGGAGGGATGGCGGTGGCTGGACATCAGGCCGGCTCGAGAGCACATAC
GTCGCCCGTCCCAGTGCCGGCAAGGTCACCAAGCTCGAGGCCGTCATCCGCTTTGGCGGCAATGGTGTCGACCGC
AAGAAGGGCATCTGGCCAGCCTTTTGGGTGCTGGGCGACTCTCACCGGCACGGGACCCCCTGGCCTGCCTGCGGC
GAGCTGGATATCATGGAGACGGTCAACGGACAGCTGACGGGCTACGGCACCGTCCACTGCGACGTCTTTCCCGGA
GGCATCTGCAACGAGGGCAACGGAATCGGCGCTGGCACTGGCTTCCCCGATCAGGGCTGGCATACCTGGTCCCTT
GAGATTGACCGCAGGCCGGGCAACTGGCAGGATCAGAGCATCACTTGGTTTATTGATGGCCGGCAATTTCACCAG
GTCAAGGGGTACCGCATCAACAAGTTTGACGTATGGGCCTCTCTGACCGACAGGCCGCTGTACTTTATCCTTAAC
CTGGCCGTTGGCGGCAAGTGGCCTGGGCCACCAGATGGGAACACGTTGGACAGTTTTGGCAGCATGATGGAGGTC
GGCTACGTGGCTCACTACTCGACTTAG
Transcript >Ophun1|425
ATGATCTCCTATCGAACGTTGGCCGCTCTCTATTACTTCCTGTCCGCCGTTTCCGCTTGGGGAGCTCCCAACTAT
GGCGGCTTCGGGCGTGTCTGGCAGGAGACCTTCTCGGGGCCGGCCGGCTCGAGTCCGAACCGGGGCAACTGGAAC
ATCATCGAGGGCAACTTGGGATACAACGAAGAGCTGCAGAGATACACGGCCTCCAACAGCAACCTGCAGCTCACC
GGCGGCGATACGTTGCAGATCATCCCCAGGAGGGATGGCGGTGGCTGGACATCAGGCCGGCTCGAGAGCACATAC
GTCGCCCGTCCCAGTGCCGGCAAGGTCACCAAGCTCGAGGCCGTCATCCGCTTTGGCGGCAATGGTGTCGACCGC
AAGAAGGGCATCTGGCCAGCCTTTTGGGTGCTGGGCGACTCTCACCGGCACGGGACCCCCTGGCCTGCCTGCGGC
GAGCTGGATATCATGGAGACGGTCAACGGACAGCTGACGGGCTACGGCACCGTCCACTGCGACGTCTTTCCCGGA
GGCATCTGCAACGAGGGCAACGGAATCGGCGCTGGCACTGGCTTCCCCGATCAGGGCTGGCATACCTGGTCCCTT
GAGATTGACCGCAGGCCGGGCAACTGGCAGGATCAGAGCATCACTTGGTTTATTGATGGCCGGCAATTTCACCAG
GTCAAGGGGTACCGCATCAACAAGTTTGACGTATGGGCCTCTCTGACCGACAGGCCGCTGTACTTTATCCTTAAC
CTGGCCGTTGGCGGCAAGTGGCCTGGGCCACCAGATGGGAACACGTTGGACAGTTTTGGCAGCATGATGGAGGTC
GGCTACGTGGCTCACTACTCGACTTAG
Gene >Ophun1|425
ATGATCTCCTATCGAACGTTGGCCGCTCTCTATTACTTCCTGTCCGCCGTTTCCGCTTGGGGAGCTCCCAACTAT
GGCGGCTTCGGGCGTGTCTGGCAGGAGACCTTCTCGGGGCCGGCCGGCTCGAGTCCGAACCGGGGCAACTGGAAC
ATCATCGAGGGCAACTTGGGATACAACGAAGAGCTGCAGAGATACACGGCCTCCAACAGCAACCTGCAGCTCACC
GGCGGCGATACGTTGCAGATCATCCCCAGGAGGGATGGCGGTGGCTGGACATCAGGCCGGCTCGAGAGCACATAC
GTCGCCCGTCCCAGTGCCGGCAAGGTCACCAAGCTCGAGGCCGTCATCCGCTTTGGCGGCAATGGTGTCGACCGC
AAGAAGGGCATCTGGCCAGCCTTTTGGGTGCTGGGCGACTCTCACCGGCACGGGACCCCCTGGCCTGCCTGCGGC
GAGCTGGATATCATGGAGACGGTCAACGGACAGCTGACGGGCTACGGCACCGTCCACTGCGACGTCTTTCCCGGA
GGCATCTGCAACGAGGGCAACGGAATCGGCGCTGGCACTGGCTTCCCCGATCAGGGCTGGCATACCTGGTCCCTT
GAGATTGACCGCAGGCCGGGCAACTGGCAGGATCAGAGCATCACTTGGTTTATTGATGGCCGGCAATTTCACCAG
GTCAAGGGGTACCGCATCAACAAGTTTGACGTATGGGCCTCTCTGACCGACAGGCCGCTGTACTTTATCCTTAAC
CTGGCCGTTGGCGGCAAGTGGGTGAGTCTCAGTTGATCTCTCAGTGTTGGTGAACTGTTGAACTGACTTTTGGAT
GACAGCCTGGGCCACCAGATGGGAACACGTTGGACAGTTTTGGCAGCATGATGGAGGTCGGCTACGTGGCTCACT
ACTCGACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail