Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4249
Gene name
LocationContig_391:12381..13755
Strand-
Gene length (bp)1374
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09440 eIF3_N eIF3 subunit 6 N terminal domain 2.3E-45 15 151
PF01399 PCI PCI domain 1.0E-09 339 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0U0X1|EIF3E_PHANO Eukaryotic translation initiation factor 3 subunit E OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INT6 PE=3 SV=3 10 439 0.0E+00
sp|Q7S519|EIF3E_NEUCR Eukaryotic translation initiation factor 3 subunit E OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=int-6 PE=3 SV=1 19 439 0.0E+00
sp|A1CKN7|EIF3E_ASPCL Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|A1D6T6|EIF3E_NEOFI Eukaryotic translation initiation factor 3 subunit E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|Q5B973|EIF3E_EMENI Eukaryotic translation initiation factor 3 subunit E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=int6 PE=3 SV=1 10 438 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0U0X1|EIF3E_PHANO Eukaryotic translation initiation factor 3 subunit E OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INT6 PE=3 SV=3 10 439 0.0E+00
sp|Q7S519|EIF3E_NEUCR Eukaryotic translation initiation factor 3 subunit E OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=int-6 PE=3 SV=1 19 439 0.0E+00
sp|A1CKN7|EIF3E_ASPCL Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|A1D6T6|EIF3E_NEOFI Eukaryotic translation initiation factor 3 subunit E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|Q5B973|EIF3E_EMENI Eukaryotic translation initiation factor 3 subunit E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=int6 PE=3 SV=1 10 438 0.0E+00
sp|Q0CNR3|EIF3E_ASPTN Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|Q2UKS9|EIF3E_ASPOR Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|A5AAA4|EIF3E_ASPNC Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q1E170|EIF3E_COCIM Eukaryotic translation initiation factor 3 subunit E OS=Coccidioides immitis (strain RS) GN=INT6 PE=3 SV=1 2 439 0.0E+00
sp|A7F3L0|EIF3E_SCLS1 Eukaryotic translation initiation factor 3 subunit E OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|A6SM77|EIF3E_BOTFB Eukaryotic translation initiation factor 3 subunit E OS=Botryotinia fuckeliana (strain B05.10) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q2HBQ2|EIF3E_CHAGB Eukaryotic translation initiation factor 3 subunit E OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=INT6 PE=3 SV=1 15 439 0.0E+00
sp|Q4WY08|EIF3E_ASPFU Eukaryotic translation initiation factor 3 subunit E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|A4R796|EIF3E_MAGO7 Eukaryotic translation initiation factor 3 subunit E OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INT6 PE=3 SV=1 15 439 0.0E+00
sp|B0XXL3|EIF3E_ASPFC Eukaryotic translation initiation factor 3 subunit E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q6C0Q2|EIF3E_YARLI Eukaryotic translation initiation factor 3 subunit E OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=INT6 PE=3 SV=1 21 438 2.0E-126
sp|Q9C5Z3|EIF3E_ARATH Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana GN=TIF3E1 PE=1 SV=1 15 430 3.0E-110
sp|Q3B8M3|EI3EB_XENLA Eukaryotic translation initiation factor 3 subunit E-B OS=Xenopus laevis GN=eif3e-b PE=2 SV=1 19 439 7.0E-110
sp|Q05AY2|EI3EA_XENLA Eukaryotic translation initiation factor 3 subunit E-A OS=Xenopus laevis GN=eif3e-a PE=2 SV=1 19 439 1.0E-109
sp|Q6P7L9|EIF3E_XENTR Eukaryotic translation initiation factor 3 subunit E OS=Xenopus tropicalis GN=eif3e PE=2 SV=1 19 439 6.0E-109
sp|Q1LUA8|EI3EB_DANRE Eukaryotic translation initiation factor 3 subunit E-B OS=Danio rerio GN=eif3eb PE=3 SV=2 19 439 1.0E-107
sp|Q3T102|EIF3E_BOVIN Eukaryotic translation initiation factor 3 subunit E OS=Bos taurus GN=EIF3E PE=2 SV=1 19 439 1.0E-106
sp|Q641X8|EIF3E_RAT Eukaryotic translation initiation factor 3 subunit E OS=Rattus norvegicus GN=Eif3e PE=2 SV=1 19 439 1.0E-106
sp|Q5R8K9|EIF3E_PONAB Eukaryotic translation initiation factor 3 subunit E OS=Pongo abelii GN=EIF3E PE=2 SV=2 19 439 1.0E-106
sp|P60229|EIF3E_MOUSE Eukaryotic translation initiation factor 3 subunit E OS=Mus musculus GN=Eif3e PE=1 SV=1 19 439 1.0E-106
sp|Q4R6G8|EIF3E_MACFA Eukaryotic translation initiation factor 3 subunit E OS=Macaca fascicularis GN=EIF3E PE=2 SV=1 19 439 1.0E-106
sp|P60228|EIF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens GN=EIF3E PE=1 SV=1 19 439 1.0E-106
sp|Q6DRI1|EI3EA_DANRE Eukaryotic translation initiation factor 3 subunit E-A OS=Danio rerio GN=eif3ea PE=2 SV=2 19 439 4.0E-106
sp|B5DGH9|EIF3E_SALSA Eukaryotic translation initiation factor 3 subunit E OS=Salmo salar GN=eif3e PE=2 SV=1 19 439 3.0E-105
sp|Q5ZLA5|EIF3E_CHICK Eukaryotic translation initiation factor 3 subunit E OS=Gallus gallus GN=EIF3E PE=2 SV=1 19 439 5.0E-105
sp|Q4PHN4|EIF3E_USTMA Eukaryotic translation initiation factor 3 subunit E OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INT6 PE=3 SV=1 19 439 1.0E-103
sp|O94513|EIF3E_SCHPO Eukaryotic translation initiation factor 3 subunit E OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=int6 PE=1 SV=1 22 439 5.0E-100
sp|A7RWP6|EIF3E_NEMVE Eukaryotic translation initiation factor 3 subunit E OS=Nematostella vectensis GN=v1g163572 PE=3 SV=1 23 439 9.0E-100
sp|P0CN50|EIF3E_CRYNJ Eukaryotic translation initiation factor 3 subunit E OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INT6 PE=3 SV=1 19 437 7.0E-95
sp|P0CN51|EIF3E_CRYNB Eukaryotic translation initiation factor 3 subunit E OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INT6 PE=3 SV=1 19 437 7.0E-95
sp|Q2F5R8|EIF3E_BOMMO Eukaryotic translation initiation factor 3 subunit E OS=Bombyx mori GN=eIF3-S6 PE=2 SV=1 19 439 9.0E-94
sp|B4N3B0|EI3E2_DROWI Eukaryotic translation initiation factor 3 subunit E-2 OS=Drosophila willistoni GN=eIF3-S6-2 PE=3 SV=1 22 433 2.0E-82
sp|B4KY00|EIF3E_DROMO Eukaryotic translation initiation factor 3 subunit E OS=Drosophila mojavensis GN=eIF3-S6 PE=3 SV=1 22 433 3.0E-82
sp|B3M4D9|EIF3E_DROAN Eukaryotic translation initiation factor 3 subunit E OS=Drosophila ananassae GN=eIF3-S6 PE=3 SV=1 22 433 3.0E-82
sp|Q29EX2|EIF3E_DROPS Eukaryotic translation initiation factor 3 subunit E OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S6 PE=3 SV=1 22 433 7.0E-82
sp|B4LG58|EIF3E_DROVI Eukaryotic translation initiation factor 3 subunit E OS=Drosophila virilis GN=eIF3-S6 PE=3 SV=1 22 433 8.0E-82
sp|B4PK98|EIF3E_DROYA Eukaryotic translation initiation factor 3 subunit E OS=Drosophila yakuba GN=eIF3-S6 PE=3 SV=1 23 433 9.0E-82
sp|B3NDH5|EIF3E_DROER Eukaryotic translation initiation factor 3 subunit E OS=Drosophila erecta GN=eIF3-S6 PE=3 SV=1 23 433 9.0E-82
sp|B4H5N1|EIF3E_DROPE Eukaryotic translation initiation factor 3 subunit E OS=Drosophila persimilis GN=eIF3-S6 PE=3 SV=1 23 433 1.0E-81
sp|B4QMY7|EIF3E_DROSI Eukaryotic translation initiation factor 3 subunit E OS=Drosophila simulans GN=eIF3-S6 PE=3 SV=1 23 433 2.0E-81
sp|O77410|EIF3E_DROME Eukaryotic translation initiation factor 3 subunit E OS=Drosophila melanogaster GN=eIF3-S6 PE=2 SV=1 23 433 2.0E-81
sp|B4IXG1|EIF3E_DROGR Eukaryotic translation initiation factor 3 subunit E OS=Drosophila grimshawi GN=eIF3-S6 PE=3 SV=1 22 433 2.0E-81
sp|B4MYA1|EI3E1_DROWI Eukaryotic translation initiation factor 3 subunit E-1 OS=Drosophila willistoni GN=eIF3-S6-1 PE=3 SV=1 22 433 9.0E-81
sp|B4HK67|EIF3E_DROSE Eukaryotic translation initiation factor 3 subunit E OS=Drosophila sechellia GN=eIF3-S6 PE=3 SV=2 23 433 8.0E-80
sp|A8NY27|EIF3E_BRUMA Eukaryotic translation initiation factor 3 subunit E OS=Brugia malayi GN=Bm1_11985 PE=3 SV=2 19 439 5.0E-79
sp|B0WAM5|EIF3E_CULQU Eukaryotic translation initiation factor 3 subunit E OS=Culex quinquefasciatus GN=eIF3-S6 PE=3 SV=1 22 439 2.0E-78
sp|Q1HQY6|EIF3E_AEDAE Eukaryotic translation initiation factor 3 subunit E OS=Aedes aegypti GN=eIF3-S6 PE=2 SV=1 22 439 1.0E-77
sp|Q7QIL8|EIF3E_ANOGA Eukaryotic translation initiation factor 3 subunit E OS=Anopheles gambiae GN=eIF3-S6 PE=3 SV=2 22 439 6.0E-75
sp|O61820|EIF3E_CAEEL Eukaryotic translation initiation factor 3 subunit E OS=Caenorhabditis elegans GN=eif-3.E PE=3 SV=1 19 439 2.0E-74
sp|A8XFH3|EIF3E_CAEBR Eukaryotic translation initiation factor 3 subunit E OS=Caenorhabditis briggsae GN=eif-3.E PE=3 SV=2 137 439 4.0E-65
sp|Q54CC5|EIF3E_DICDI Eukaryotic translation initiation factor 3 subunit E OS=Dictyostelium discoideum GN=eif3E PE=3 SV=1 136 429 4.0E-63
sp|A9UQS1|EIF3E_MONBE Eukaryotic translation initiation factor 3 subunit E OS=Monosiga brevicollis GN=13685 PE=3 SV=1 19 433 2.0E-50
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2686
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2563
Ophiocordyceps australis map64 (Brazil) OphauB2|6613
Ophiocordyceps camponoti-floridani Ophcf2|05220
Ophiocordyceps camponoti-rufipedis Ophun1|4249 (this protein)
Ophiocordyceps kimflemingae Ophio5|7958
Ophiocordyceps subramaniannii Hirsu2|4191

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4249
MEEILKAVPADGSSMMPLLAPHLSRHLLFPLIQFEGDKAEEKGDDERAKKILSGKIKLLEDTNMTDYVATLYCDL
HGAANPPAEYTKKRQEVLAQLEKYEQATAKIADLLTQDDVVNGLRSDKVANLEFLKNQHGVTMEMVNALYDFGQF
QFRCGQYGPAADMLYQFRVLSTDNDKVSASTWGKLASEILSTNWESAVDELKNVREGIDTKLFSNPRAQLDHRTM
LVHWALFPLFNWEGAREPILDVFFSAAYINTIQTSCPWILRYLIAAVITGRTRARNSSIQQKQLKDIIRYVRQEA
YEYVDPITQFIHALYIAHDFDAARDALGMAEEVCRGDFFLASSADGFVGAARHLICESYCKIFSRMNIRDLSGKL
GLNPDEGEKWIVNLIRETRLDAKIDSKDGTVIMNHPPNNVYQQVIEKTKGGFFRTQVLNAAMSK*
Coding >Ophun1|4249
ATGGAGGAAATACTCAAGGCCGTCCCCGCCGACGGGTCATCGATGATGCCGCTCCTGGCACCGCACCTGAGCCGA
CACCTGCTCTTCCCGCTGATCCAGTTCGAAGGTGACAAGGCAGAGGAGAAGGGCGACGATGAGCGGGCAAAGAAG
ATCCTGTCGGGCAAGATCAAGCTGCTCGAGGATACCAACATGACCGACTATGTTGCCACGCTGTACTGCGATCTT
CACGGCGCGGCAAACCCGCCGGCTGAGTACACCAAGAAGAGACAGGAGGTGTTGGCGCAGCTTGAAAAGTACGAG
CAGGCGACGGCCAAGATTGCCGATCTGTTGACGCAGGACGATGTCGTCAATGGATTGAGGAGCGACAAGGTGGCC
AATCTGGAGTTTCTCAAGAACCAGCATGGGGTCACGATGGAAATGGTCAACGCGCTCTACGACTTTGGCCAGTTT
CAGTTCCGATGCGGTCAGTACGGACCGGCGGCCGACATGCTGTACCAGTTCCGCGTGCTATCGACGGACAACGAC
AAGGTCTCGGCGTCGACATGGGGCAAGCTCGCGTCCGAGATCCTCTCAACCAACTGGGAGTCGGCCGTGGACGAG
CTCAAGAACGTGCGCGAGGGCATCGACACCAAGCTCTTCAGCAACCCACGCGCGCAGCTCGACCACCGCACCATG
CTCGTTCACTGGGCTCTCTTCCCGCTCTTCAACTGGGAGGGCGCACGAGAGCCCATCCTCGACGTCTTCTTCTCG
GCCGCCTACATCAACACAATTCAGACGTCGTGCCCTTGGATCCTTCGCTACCTCATCGCGGCTGTCATCACCGGC
CGGACGCGGGCGCGCAACAGCTCGATCCAACAGAAGCAGCTCAAGGACATCATCCGATACGTCCGACAGGAGGCG
TACGAATACGTCGATCCCATCACGCAATTCATCCACGCCCTCTACATCGCGCACGACTTCGACGCCGCCCGCGAC
GCCCTGGGGATGGCGGAGGAGGTCTGCCGCGGCGACTTCTTCCTCGCCTCGTCGGCAGACGGCTTCGTCGGCGCA
GCCAGACACCTCATCTGCGAAAGCTACTGCAAGATCTTCAGCCGGATGAACATCCGCGACCTGAGCGGCAAGCTG
GGTCTCAACCCGGACGAGGGCGAGAAATGGATCGTCAACCTGATTCGCGAGACGCGCCTCGACGCAAAGATTGAC
AGCAAGGATGGGACCGTCATCATGAATCATCCGCCTAACAATGTGTATCAGCAGGTTATTGAGAAGACCAAGGGT
GGTTTCTTTAGGACGCAGGTGTTGAACGCGGCCATGTCCAAGTAG
Transcript >Ophun1|4249
ATGGAGGAAATACTCAAGGCCGTCCCCGCCGACGGGTCATCGATGATGCCGCTCCTGGCACCGCACCTGAGCCGA
CACCTGCTCTTCCCGCTGATCCAGTTCGAAGGTGACAAGGCAGAGGAGAAGGGCGACGATGAGCGGGCAAAGAAG
ATCCTGTCGGGCAAGATCAAGCTGCTCGAGGATACCAACATGACCGACTATGTTGCCACGCTGTACTGCGATCTT
CACGGCGCGGCAAACCCGCCGGCTGAGTACACCAAGAAGAGACAGGAGGTGTTGGCGCAGCTTGAAAAGTACGAG
CAGGCGACGGCCAAGATTGCCGATCTGTTGACGCAGGACGATGTCGTCAATGGATTGAGGAGCGACAAGGTGGCC
AATCTGGAGTTTCTCAAGAACCAGCATGGGGTCACGATGGAAATGGTCAACGCGCTCTACGACTTTGGCCAGTTT
CAGTTCCGATGCGGTCAGTACGGACCGGCGGCCGACATGCTGTACCAGTTCCGCGTGCTATCGACGGACAACGAC
AAGGTCTCGGCGTCGACATGGGGCAAGCTCGCGTCCGAGATCCTCTCAACCAACTGGGAGTCGGCCGTGGACGAG
CTCAAGAACGTGCGCGAGGGCATCGACACCAAGCTCTTCAGCAACCCACGCGCGCAGCTCGACCACCGCACCATG
CTCGTTCACTGGGCTCTCTTCCCGCTCTTCAACTGGGAGGGCGCACGAGAGCCCATCCTCGACGTCTTCTTCTCG
GCCGCCTACATCAACACAATTCAGACGTCGTGCCCTTGGATCCTTCGCTACCTCATCGCGGCTGTCATCACCGGC
CGGACGCGGGCGCGCAACAGCTCGATCCAACAGAAGCAGCTCAAGGACATCATCCGATACGTCCGACAGGAGGCG
TACGAATACGTCGATCCCATCACGCAATTCATCCACGCCCTCTACATCGCGCACGACTTCGACGCCGCCCGCGAC
GCCCTGGGGATGGCGGAGGAGGTCTGCCGCGGCGACTTCTTCCTCGCCTCGTCGGCAGACGGCTTCGTCGGCGCA
GCCAGACACCTCATCTGCGAAAGCTACTGCAAGATCTTCAGCCGGATGAACATCCGCGACCTGAGCGGCAAGCTG
GGTCTCAACCCGGACGAGGGCGAGAAATGGATCGTCAACCTGATTCGCGAGACGCGCCTCGACGCAAAGATTGAC
AGCAAGGATGGGACCGTCATCATGAATCATCCGCCTAACAATGTGTATCAGCAGGTTATTGAGAAGACCAAGGGT
GGTTTCTTTAGGACGCAGGTGTTGAACGCGGCCATGTCCAAGTAG
Gene >Ophun1|4249
ATGGAGGAAATACTCAAGGCCGTCCCCGCCGACGGGTCATCGATGATGCCGCTCCTGGCACCGCACCTGAGCCGA
CACCTGCTCTTCCCGCTGATCCAGTTCGAAGGTGACAAGGCAGAGGAGAAGGGCGACGATGAGCGGGCAAAGAAG
ATCCTGTCGGGCAAGATCAAGCTGCTCGAGGATACCAACATGACCGACTATGTTGCCACGCTGTACTGCGATCTT
CACGGCGCGGCAAACCCGCCGGCTGAGTACACCAAGAAGAGACAGGAGGTGTTGGCGCAGCTTGAAAAGTACGAG
CAGGCGACGGCCAAGATTGCCGATCTGTTGACGCAGGACGATGTCGTCAATGGATTGAGGAGCGACAAGGTGGCC
AATCTGGAGTTTCTCAAGAACCAGCATGGGGTGAGGGAGATTTTCTCTGCAGCTTCATCCTCTTCTGATCTGACG
TTTCGCCAGGTCACGATGGAAATGGTCAACGCGCTCTACGACTTTGGCCAGTTTCAGTTCCGATGCGGTCAGTAC
GGACCGGCGGCCGACATGCTGTACCAGTTCCGCGTGCTATCGACGGACAACGACAAGGTCTCGGCGTCGACATGG
GGCAAGCTCGCGTCCGAGATCCTCTCAACCAACTGGGAGTCGGCCGTGGACGAGCTCAAGAACGTGCGCGAGGGC
ATCGACACCAAGCTCTTCAGCAACCCACGCGCGCAGCTCGACCACCGCACCATGCTCGTTCACTGGGCTCTCTTC
CCGCTCTTCAACTGGGAGGGCGCACGAGAGCCCATCCTCGACGTCTTCTTCTCGGCCGCCTACATCAACACAATT
CAGACGTCGTGCCCTTGGATCCTTCGCTACCTCATCGCGGCTGTCATCACCGGCCGGACGCGGGCGCGCAACAGC
TCGATCCAACAGAAGCAGCTCAAGGACATCATCCGATACGTCCGACAGGAGGCGTACGAATACGTCGATCCCATC
ACGCAATTCATCCACGCCCTCTACATCGCGCACGACTTCGACGCCGCCCGCGACGCCCTGGGGATGGCGGAGGAG
GTCTGCCGCGGCGACTTCTTCCTCGCCTCGTCGGCAGACGGCTTCGTCGGCGCAGCCAGACACCTCATCTGCGAA
AGCTACTGCAAGATCTTCAGCCGGATGAACATCCGCGACCTGAGCGGCAAGCTGGGTCTCAACCCGGACGAGGGC
GAGAAATGGATCGTCAACCTGATTCGCGAGACGCGCCTCGACGCAAAGATTGACAGCAAGGATGGGACCGTCATC
ATGAATCATCCGCCTAACAATGTGTATCAGCAGGTTATTGAGAAGACCAAGGGTGGTTTCTTTAGGACGCAGGTG
TTGAACGCGGCCATGTCCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail