Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4241
Gene name
LocationContig_390:713..4058
Strand-
Gene length (bp)3345
Transcript length (bp)3288
Coding sequence length (bp)3288
Protein length (aa) 1096

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01074 Glyco_hydro_38N Glycosyl hydrolases family 38 N-terminal domain 1.5E-85 283 545
PF07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain 8.8E-51 737 945
PF09261 Alpha-mann_mid Alpha mannosidase middle domain 3.5E-24 552 641
PF17677 Glyco_hydro38C2 Glycosyl hydrolases family 38 C-terminal beta sandwich domain 1.2E-10 1031 1092

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT61|MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ams1 PE=3 SV=1 13 1095 0.0E+00
sp|P22855|MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMS1 PE=1 SV=2 20 1093 0.0E+00
sp|Q54K67|MANG_DICDI Alpha-mannosidase G OS=Dictyostelium discoideum GN=manG PE=1 SV=1 31 1093 0.0E+00
sp|Q91W89|MA2C1_MOUSE Alpha-mannosidase 2C1 OS=Mus musculus GN=Man2c1 PE=1 SV=1 31 1095 0.0E+00
sp|Q9NTJ4|MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens GN=MAN2C1 PE=1 SV=1 31 1086 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT61|MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ams1 PE=3 SV=1 13 1095 0.0E+00
sp|P22855|MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMS1 PE=1 SV=2 20 1093 0.0E+00
sp|Q54K67|MANG_DICDI Alpha-mannosidase G OS=Dictyostelium discoideum GN=manG PE=1 SV=1 31 1093 0.0E+00
sp|Q91W89|MA2C1_MOUSE Alpha-mannosidase 2C1 OS=Mus musculus GN=Man2c1 PE=1 SV=1 31 1095 0.0E+00
sp|Q9NTJ4|MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens GN=MAN2C1 PE=1 SV=1 31 1086 0.0E+00
sp|P21139|MA2C1_RAT Alpha-mannosidase 2C1 OS=Rattus norvegicus GN=Man2c1 PE=1 SV=1 31 1095 0.0E+00
sp|P54746|MNGB_ECOLI Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) GN=mngB PE=1 SV=2 283 938 3.0E-14
sp|P49641|MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens GN=MAN2A2 PE=2 SV=3 278 626 1.0E-10
sp|Q8BRK9|MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus GN=Man2a2 PE=1 SV=2 279 715 1.0E-09
sp|Q9KER1|MNGB_BACHD Putative mannosylglycerate hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mngB PE=3 SV=2 827 1093 4.0E-07
sp|P27046|MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus GN=Man2a1 PE=1 SV=2 283 460 5.0E-07
sp|Q16706|MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens GN=MAN2A1 PE=1 SV=2 283 460 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004559 alpha-mannosidase activity Yes
GO:0006013 mannose metabolic process Yes
GO:0005996 monosaccharide metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0019318 hexose metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044281 small molecule metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0044238 primary metabolic process No
GO:0015923 mannosidase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH38 7.7E-84 283 540

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4671
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6076
Ophiocordyceps australis map64 (Brazil) OphauB2|1696
Ophiocordyceps camponoti-floridani Ophcf2|00411
Ophiocordyceps camponoti-rufipedis Ophun1|4241 (this protein)
Ophiocordyceps kimflemingae Ophio5|6823
Ophiocordyceps subramaniannii Hirsu2|9842

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4241
MGGGGQAKSNGSYSVFARKPVGVPKTSILKDRIELFYKSGQYDKVNLLANLFKARYSGKPHVKLYVWSAPDQERP
TFKEAVSHEFKETATGASFGPSWSTHWFRIHLTLPKDALDEELVVFEWDAGNEGLVWAPDGTPLQGLTGGGERVE
WNIPKSFRDGKEHVIYIEMACNGMFGNAPSGKTSIAPPDPNRYYTLTRADIAVVNVPARMLHFDMWELGDAAREL
PETSAEQNKALAVAMKIIDTFQVDDQESILECRKLAREIIGPDVDSHKVYEVGKDPVVYGIGHCHIDTCWLWPWA
ETKRKICRSWLSQCDLMDRYPEAHFACSSAQQFKWLKEYYPSAFSRVKNKVSEGQFHPIGGSWVEHDTNMPSGES
LVRQFFYGQRFFEAEFGSRCRTFWLPDTFGYSSQLPQLCRLAGMERFMTQKLSWNNINTFPHTTFMWVSPDGSQV
ICHMPPSETYTSDANFGDLSRSISQHKTLRVDSSSLLVFGKGDGGGGPTWQHFEKLRRCAGISNTIGAIPKLKLG
LTVDDFFDRLAPKAGEFPTWYGELYFELHRGTYTTQANNKFFNRKAEVMLRDIEQLATFASIKSDKYSYPSKVID
DMWEAVLLCQFHDCLPGSSIEMCYDDSDEVSQSRSQCKMLMAYDDGWQLYAELFKKGQALLKDLYGHLGVSEEPI
GSPGGSVALNTLPWHREEIVEVSNKEVGIASGDGQLLSLRTFEMTADKPAVRLTEDKDAFVLENDHLRVVVEGGC
ITSLYDRVNNREVVEKGGQANKFVIFDDIPLFWEAWDVEVYHLETERQLTYGKTKIHESKPHKATLVTDIKISDK
SSLKAYISLSAAVKGQTSRVDCSAEIEWHEDSKFLKVEFPVDVVNTQASYESAYTITKRPTHYNTSWDMAKFEVC
CHRFADLSENNYGVSIFNDSKYGFATVGKMMRLSLLRAPKAPDAHADMGHHSIRWAIFPHEGYLSSETVRAAYAF
NNPLKLLSASETRLWSEAPITLTNVEDSASLILDCIKRGHDDEDVSRCQGLPVAKGRSVVLRVYESLGGRSRGTI
RTKLGVKRVFKSNLLEDELHEIKIVDGEFSIELRPFEVATYKLAL*
Coding >Ophun1|4241
ATGGGCGGCGGTGGACAAGCCAAGAGCAACGGCTCTTACTCTGTTTTCGCCCGGAAACCCGTCGGCGTCCCCAAG
ACGAGCATCCTCAAGGACCGCATCGAGCTCTTCTACAAGTCTGGCCAGTACGACAAGGTCAACCTGCTCGCCAAC
CTTTTCAAAGCCAGATATTCTGGTAAGCCGCACGTCAAGCTCTACGTTTGGAGCGCCCCGGACCAGGAACGTCCA
ACTTTTAAGGAAGCTGTATCCCACGAATTCAAGGAGACTGCCACTGGCGCCTCGTTCGGACCCTCGTGGTCGACG
CACTGGTTCAGGATTCATCTGACGTTGCCCAAGGACGCCCTTGACGAGGAGCTCGTCGTTTTCGAATGGGATGCC
GGCAACGAGGGCCTGGTCTGGGCACCCGATGGCACCCCTCTCCAGGGCCTGACGGGCGGCGGCGAGCGCGTTGAA
TGGAACATCCCCAAGTCGTTCCGTGATGGCAAGGAGCATGTCATCTACATCGAAATGGCCTGCAACGGCATGTTT
GGCAACGCGCCCAGCGGCAAGACCAGCATCGCTCCTCCGGATCCGAACCGCTACTACACTCTGACCAGGGCCGAC
ATCGCCGTTGTCAACGTGCCCGCCCGTATGCTGCACTTCGACATGTGGGAACTCGGCGACGCCGCGCGGGAGCTG
CCCGAGACCTCGGCCGAGCAGAACAAGGCCCTTGCGGTTGCCATGAAAATCATCGACACCTTTCAGGTGGACGAC
CAAGAGTCCATTCTCGAGTGCCGAAAGCTCGCTCGCGAAATCATCGGTCCCGACGTCGATTCGCACAAGGTGTAC
GAGGTCGGCAAGGACCCCGTCGTCTACGGCATCGGCCATTGCCACATCGACACGTGCTGGCTCTGGCCCTGGGCC
GAGACGAAGCGAAAGATCTGTAGGTCCTGGCTGAGCCAGTGTGATCTGATGGATCGCTACCCAGAGGCGCACTTC
GCCTGCTCTTCGGCCCAGCAGTTCAAGTGGCTAAAGGAATACTACCCCAGTGCCTTTTCGCGCGTCAAGAACAAG
GTATCGGAGGGCCAGTTCCACCCCATCGGCGGCAGCTGGGTCGAGCACGACACCAACATGCCGAGCGGCGAGTCG
CTCGTCCGTCAGTTCTTCTACGGCCAGAGGTTCTTTGAGGCCGAGTTCGGCTCCCGTTGCCGCACCTTTTGGCTG
CCCGACACGTTCGGCTACTCGAGCCAGCTCCCGCAGCTCTGTCGTCTCGCCGGCATGGAACGCTTCATGACGCAG
AAGCTTAGCTGGAACAACATCAACACGTTCCCGCACACGACGTTTATGTGGGTGAGTCCCGACGGCAGCCAGGTC
ATCTGCCACATGCCGCCCTCGGAGACGTACACGTCCGACGCCAACTTTGGCGATCTCTCGCGGAGCATCTCTCAG
CACAAGACGCTACGCGTCGACTCGTCGTCCCTGCTGGTCTTTGGCAAGGGCGATGGCGGCGGAGGCCCGACCTGG
CAGCACTTTGAGAAGCTCCGACGCTGCGCCGGCATCAGCAACACCATCGGAGCCATTCCCAAGCTCAAGCTGGGC
CTCACCGTCGACGACTTCTTCGACCGGCTGGCACCCAAGGCAGGCGAGTTCCCGACCTGGTACGGCGAGCTGTAC
TTTGAGCTGCACCGCGGCACCTACACAACCCAGGCCAACAACAAGTTCTTCAACCGCAAGGCCGAGGTGATGCTC
CGCGACATCGAGCAGCTGGCGACGTTTGCGTCCATCAAGAGCGACAAGTACAGTTACCCGTCCAAGGTGATTGAC
GACATGTGGGAGGCTGTGCTGCTGTGCCAGTTTCACGACTGTCTTCCGGGCAGCTCCATCGAGATGTGCTACGAC
GATTCGGACGAGGTAAGCCAGAGTCGTTCCCAATGCAAGATGCTCATGGCTTATGATGACGGATGGCAGCTGTAC
GCCGAGCTCTTCAAGAAGGGGCAGGCGCTTCTCAAGGATCTGTACGGCCACCTGGGTGTCTCCGAGGAGCCTATC
GGTAGCCCTGGCGGATCGGTTGCTCTCAACACTCTTCCTTGGCATCGCGAGGAAATCGTTGAGGTATCGAACAAG
GAGGTGGGAATCGCCAGCGGAGACGGCCAGCTCCTCTCCCTTCGCACCTTTGAGATGACGGCGGACAAGCCGGCG
GTGCGACTGACGGAGGACAAGGACGCCTTCGTGTTGGAGAACGACCATCTCCGCGTCGTGGTCGAAGGCGGCTGC
ATCACGTCCCTCTACGATCGCGTCAACAACCGGGAGGTGGTGGAAAAGGGCGGCCAGGCCAACAAGTTTGTCATC
TTTGACGACATTCCGCTCTTCTGGGAGGCGTGGGATGTCGAAGTCTACCATCTCGAGACGGAGAGGCAGCTCACG
TACGGCAAGACCAAGATTCACGAGAGCAAGCCGCACAAGGCGACGCTGGTGACGGACATCAAGATCAGCGACAAG
AGCTCTCTCAAGGCCTACATCAGCCTCTCGGCAGCCGTCAAGGGCCAGACGTCGAGGGTGGACTGCTCTGCCGAG
ATTGAGTGGCACGAGGACTCCAAGTTCCTCAAGGTCGAGTTCCCCGTCGACGTGGTCAACACGCAGGCGTCGTAC
GAATCGGCCTATACCATTACCAAGCGACCGACGCACTACAACACGAGCTGGGACATGGCCAAGTTCGAGGTGTGC
TGCCACCGGTTCGCCGATCTGTCGGAGAACAACTACGGCGTGTCCATCTTCAACGACAGCAAGTACGGCTTCGCC
ACGGTGGGCAAGATGATGCGGCTCTCGCTGCTGCGCGCTCCCAAGGCGCCCGACGCGCACGCCGACATGGGCCAT
CACTCGATCCGCTGGGCCATCTTCCCCCACGAGGGATACCTTTCGTCGGAGACGGTCAGGGCCGCCTATGCCTTC
AACAACCCGCTCAAGCTGCTTTCGGCGTCGGAGACTCGGCTCTGGTCGGAGGCGCCCATCACCTTGACCAACGTC
GAGGATTCTGCGTCGCTGATCCTCGACTGCATCAAGCGCGGGCACGACGACGAGGACGTCAGCCGTTGCCAGGGA
CTGCCCGTCGCCAAGGGTCGGAGCGTCGTGCTGCGCGTGTACGAGTCGCTGGGAGGCCGGAGCAGGGGTACAATC
CGTACCAAACTGGGCGTGAAGCGCGTCTTCAAGAGCAATTTGCTGGAGGACGAGCTGCACGAGATCAAGATTGTC
GACGGAGAGTTTAGCATTGAGTTGCGACCGTTTGAGGTGGCGACATACAAGCTGGCGCTCTAG
Transcript >Ophun1|4241
ATGGGCGGCGGTGGACAAGCCAAGAGCAACGGCTCTTACTCTGTTTTCGCCCGGAAACCCGTCGGCGTCCCCAAG
ACGAGCATCCTCAAGGACCGCATCGAGCTCTTCTACAAGTCTGGCCAGTACGACAAGGTCAACCTGCTCGCCAAC
CTTTTCAAAGCCAGATATTCTGGTAAGCCGCACGTCAAGCTCTACGTTTGGAGCGCCCCGGACCAGGAACGTCCA
ACTTTTAAGGAAGCTGTATCCCACGAATTCAAGGAGACTGCCACTGGCGCCTCGTTCGGACCCTCGTGGTCGACG
CACTGGTTCAGGATTCATCTGACGTTGCCCAAGGACGCCCTTGACGAGGAGCTCGTCGTTTTCGAATGGGATGCC
GGCAACGAGGGCCTGGTCTGGGCACCCGATGGCACCCCTCTCCAGGGCCTGACGGGCGGCGGCGAGCGCGTTGAA
TGGAACATCCCCAAGTCGTTCCGTGATGGCAAGGAGCATGTCATCTACATCGAAATGGCCTGCAACGGCATGTTT
GGCAACGCGCCCAGCGGCAAGACCAGCATCGCTCCTCCGGATCCGAACCGCTACTACACTCTGACCAGGGCCGAC
ATCGCCGTTGTCAACGTGCCCGCCCGTATGCTGCACTTCGACATGTGGGAACTCGGCGACGCCGCGCGGGAGCTG
CCCGAGACCTCGGCCGAGCAGAACAAGGCCCTTGCGGTTGCCATGAAAATCATCGACACCTTTCAGGTGGACGAC
CAAGAGTCCATTCTCGAGTGCCGAAAGCTCGCTCGCGAAATCATCGGTCCCGACGTCGATTCGCACAAGGTGTAC
GAGGTCGGCAAGGACCCCGTCGTCTACGGCATCGGCCATTGCCACATCGACACGTGCTGGCTCTGGCCCTGGGCC
GAGACGAAGCGAAAGATCTGTAGGTCCTGGCTGAGCCAGTGTGATCTGATGGATCGCTACCCAGAGGCGCACTTC
GCCTGCTCTTCGGCCCAGCAGTTCAAGTGGCTAAAGGAATACTACCCCAGTGCCTTTTCGCGCGTCAAGAACAAG
GTATCGGAGGGCCAGTTCCACCCCATCGGCGGCAGCTGGGTCGAGCACGACACCAACATGCCGAGCGGCGAGTCG
CTCGTCCGTCAGTTCTTCTACGGCCAGAGGTTCTTTGAGGCCGAGTTCGGCTCCCGTTGCCGCACCTTTTGGCTG
CCCGACACGTTCGGCTACTCGAGCCAGCTCCCGCAGCTCTGTCGTCTCGCCGGCATGGAACGCTTCATGACGCAG
AAGCTTAGCTGGAACAACATCAACACGTTCCCGCACACGACGTTTATGTGGGTGAGTCCCGACGGCAGCCAGGTC
ATCTGCCACATGCCGCCCTCGGAGACGTACACGTCCGACGCCAACTTTGGCGATCTCTCGCGGAGCATCTCTCAG
CACAAGACGCTACGCGTCGACTCGTCGTCCCTGCTGGTCTTTGGCAAGGGCGATGGCGGCGGAGGCCCGACCTGG
CAGCACTTTGAGAAGCTCCGACGCTGCGCCGGCATCAGCAACACCATCGGAGCCATTCCCAAGCTCAAGCTGGGC
CTCACCGTCGACGACTTCTTCGACCGGCTGGCACCCAAGGCAGGCGAGTTCCCGACCTGGTACGGCGAGCTGTAC
TTTGAGCTGCACCGCGGCACCTACACAACCCAGGCCAACAACAAGTTCTTCAACCGCAAGGCCGAGGTGATGCTC
CGCGACATCGAGCAGCTGGCGACGTTTGCGTCCATCAAGAGCGACAAGTACAGTTACCCGTCCAAGGTGATTGAC
GACATGTGGGAGGCTGTGCTGCTGTGCCAGTTTCACGACTGTCTTCCGGGCAGCTCCATCGAGATGTGCTACGAC
GATTCGGACGAGGTAAGCCAGAGTCGTTCCCAATGCAAGATGCTCATGGCTTATGATGACGGATGGCAGCTGTAC
GCCGAGCTCTTCAAGAAGGGGCAGGCGCTTCTCAAGGATCTGTACGGCCACCTGGGTGTCTCCGAGGAGCCTATC
GGTAGCCCTGGCGGATCGGTTGCTCTCAACACTCTTCCTTGGCATCGCGAGGAAATCGTTGAGGTATCGAACAAG
GAGGTGGGAATCGCCAGCGGAGACGGCCAGCTCCTCTCCCTTCGCACCTTTGAGATGACGGCGGACAAGCCGGCG
GTGCGACTGACGGAGGACAAGGACGCCTTCGTGTTGGAGAACGACCATCTCCGCGTCGTGGTCGAAGGCGGCTGC
ATCACGTCCCTCTACGATCGCGTCAACAACCGGGAGGTGGTGGAAAAGGGCGGCCAGGCCAACAAGTTTGTCATC
TTTGACGACATTCCGCTCTTCTGGGAGGCGTGGGATGTCGAAGTCTACCATCTCGAGACGGAGAGGCAGCTCACG
TACGGCAAGACCAAGATTCACGAGAGCAAGCCGCACAAGGCGACGCTGGTGACGGACATCAAGATCAGCGACAAG
AGCTCTCTCAAGGCCTACATCAGCCTCTCGGCAGCCGTCAAGGGCCAGACGTCGAGGGTGGACTGCTCTGCCGAG
ATTGAGTGGCACGAGGACTCCAAGTTCCTCAAGGTCGAGTTCCCCGTCGACGTGGTCAACACGCAGGCGTCGTAC
GAATCGGCCTATACCATTACCAAGCGACCGACGCACTACAACACGAGCTGGGACATGGCCAAGTTCGAGGTGTGC
TGCCACCGGTTCGCCGATCTGTCGGAGAACAACTACGGCGTGTCCATCTTCAACGACAGCAAGTACGGCTTCGCC
ACGGTGGGCAAGATGATGCGGCTCTCGCTGCTGCGCGCTCCCAAGGCGCCCGACGCGCACGCCGACATGGGCCAT
CACTCGATCCGCTGGGCCATCTTCCCCCACGAGGGATACCTTTCGTCGGAGACGGTCAGGGCCGCCTATGCCTTC
AACAACCCGCTCAAGCTGCTTTCGGCGTCGGAGACTCGGCTCTGGTCGGAGGCGCCCATCACCTTGACCAACGTC
GAGGATTCTGCGTCGCTGATCCTCGACTGCATCAAGCGCGGGCACGACGACGAGGACGTCAGCCGTTGCCAGGGA
CTGCCCGTCGCCAAGGGTCGGAGCGTCGTGCTGCGCGTGTACGAGTCGCTGGGAGGCCGGAGCAGGGGTACAATC
CGTACCAAACTGGGCGTGAAGCGCGTCTTCAAGAGCAATTTGCTGGAGGACGAGCTGCACGAGATCAAGATTGTC
GACGGAGAGTTTAGCATTGAGTTGCGACCGTTTGAGGTGGCGACATACAAGCTGGCGCTCTAG
Gene >Ophun1|4241
ATGGGCGGCGGTGGACAAGCCAAGAGCAACGGCTCTTACTCTGTTTTCGCCCGGAAACCCGTCGGCGTCCCCAAG
ACGAGCATCCTCAAGGACCGCATCGAGCTCTTCTACAAGTCTGGCCAGTACGACAAGGTCAACCTGCTCGCGTGA
GTCTACCACCCCTCCCGTATTCGAACCCTCATGCTAACCTTTAACCTCTTTAGCAACCTTTTCAAAGCCAGATAT
TCTGGTAAGCCGCACGTCAAGCTCTACGTTTGGAGCGCCCCGGACCAGGAACGTCCAACTTTTAAGGAAGCTGTA
TCCCACGAATTCAAGGAGACTGCCACTGGCGCCTCGTTCGGACCCTCGTGGTCGACGCACTGGTTCAGGATTCAT
CTGACGTTGCCCAAGGACGCCCTTGACGAGGAGCTCGTCGTTTTCGAATGGGATGCCGGCAACGAGGGCCTGGTC
TGGGCACCCGATGGCACCCCTCTCCAGGGCCTGACGGGCGGCGGCGAGCGCGTTGAATGGAACATCCCCAAGTCG
TTCCGTGATGGCAAGGAGCATGTCATCTACATCGAAATGGCCTGCAACGGCATGTTTGGCAACGCGCCCAGCGGC
AAGACCAGCATCGCTCCTCCGGATCCGAACCGCTACTACACTCTGACCAGGGCCGACATCGCCGTTGTCAACGTG
CCCGCCCGTATGCTGCACTTCGACATGTGGGAACTCGGCGACGCCGCGCGGGAGCTGCCCGAGACCTCGGCCGAG
CAGAACAAGGCCCTTGCGGTTGCCATGAAAATCATCGACACCTTTCAGGTGGACGACCAAGAGTCCATTCTCGAG
TGCCGAAAGCTCGCTCGCGAAATCATCGGTCCCGACGTCGATTCGCACAAGGTGTACGAGGTCGGCAAGGACCCC
GTCGTCTACGGCATCGGCCATTGCCACATCGACACGTGCTGGCTCTGGCCCTGGGCCGAGACGAAGCGAAAGATC
TGTAGGTCCTGGCTGAGCCAGTGTGATCTGATGGATCGCTACCCAGAGGCGCACTTCGCCTGCTCTTCGGCCCAG
CAGTTCAAGTGGCTAAAGGAATACTACCCCAGTGCCTTTTCGCGCGTCAAGAACAAGGTATCGGAGGGCCAGTTC
CACCCCATCGGCGGCAGCTGGGTCGAGCACGACACCAACATGCCGAGCGGCGAGTCGCTCGTCCGTCAGTTCTTC
TACGGCCAGAGGTTCTTTGAGGCCGAGTTCGGCTCCCGTTGCCGCACCTTTTGGCTGCCCGACACGTTCGGCTAC
TCGAGCCAGCTCCCGCAGCTCTGTCGTCTCGCCGGCATGGAACGCTTCATGACGCAGAAGCTTAGCTGGAACAAC
ATCAACACGTTCCCGCACACGACGTTTATGTGGGTGAGTCCCGACGGCAGCCAGGTCATCTGCCACATGCCGCCC
TCGGAGACGTACACGTCCGACGCCAACTTTGGCGATCTCTCGCGGAGCATCTCTCAGCACAAGACGCTACGCGTC
GACTCGTCGTCCCTGCTGGTCTTTGGCAAGGGCGATGGCGGCGGAGGCCCGACCTGGCAGCACTTTGAGAAGCTC
CGACGCTGCGCCGGCATCAGCAACACCATCGGAGCCATTCCCAAGCTCAAGCTGGGCCTCACCGTCGACGACTTC
TTCGACCGGCTGGCACCCAAGGCAGGCGAGTTCCCGACCTGGTACGGCGAGCTGTACTTTGAGCTGCACCGCGGC
ACCTACACAACCCAGGCCAACAACAAGTTCTTCAACCGCAAGGCCGAGGTGATGCTCCGCGACATCGAGCAGCTG
GCGACGTTTGCGTCCATCAAGAGCGACAAGTACAGTTACCCGTCCAAGGTGATTGACGACATGTGGGAGGCTGTG
CTGCTGTGCCAGTTTCACGACTGTCTTCCGGGCAGCTCCATCGAGATGTGCTACGACGATTCGGACGAGGTAAGC
CAGAGTCGTTCCCAATGCAAGATGCTCATGGCTTATGATGACGGATGGCAGCTGTACGCCGAGCTCTTCAAGAAG
GGGCAGGCGCTTCTCAAGGATCTGTACGGCCACCTGGGTGTCTCCGAGGAGCCTATCGGTAGCCCTGGCGGATCG
GTTGCTCTCAACACTCTTCCTTGGCATCGCGAGGAAATCGTTGAGGTATCGAACAAGGAGGTGGGAATCGCCAGC
GGAGACGGCCAGCTCCTCTCCCTTCGCACCTTTGAGATGACGGCGGACAAGCCGGCGGTGCGACTGACGGAGGAC
AAGGACGCCTTCGTGTTGGAGAACGACCATCTCCGCGTCGTGGTCGAAGGCGGCTGCATCACGTCCCTCTACGAT
CGCGTCAACAACCGGGAGGTGGTGGAAAAGGGCGGCCAGGCCAACAAGTTTGTCATCTTTGACGACATTCCGCTC
TTCTGGGAGGCGTGGGATGTCGAAGTCTACCATCTCGAGACGGAGAGGCAGCTCACGTACGGCAAGACCAAGATT
CACGAGAGCAAGCCGCACAAGGCGACGCTGGTGACGGACATCAAGATCAGCGACAAGAGCTCTCTCAAGGCCTAC
ATCAGCCTCTCGGCAGCCGTCAAGGGCCAGACGTCGAGGGTGGACTGCTCTGCCGAGATTGAGTGGCACGAGGAC
TCCAAGTTCCTCAAGGTCGAGTTCCCCGTCGACGTGGTCAACACGCAGGCGTCGTACGAATCGGCCTATACCATT
ACCAAGCGACCGACGCACTACAACACGAGCTGGGACATGGCCAAGTTCGAGGTGTGCTGCCACCGGTTCGCCGAT
CTGTCGGAGAACAACTACGGCGTGTCCATCTTCAACGACAGCAAGTACGGCTTCGCCACGGTGGGCAAGATGATG
CGGCTCTCGCTGCTGCGCGCTCCCAAGGCGCCCGACGCGCACGCCGACATGGGCCATCACTCGATCCGCTGGGCC
ATCTTCCCCCACGAGGGATACCTTTCGTCGGAGACGGTCAGGGCCGCCTATGCCTTCAACAACCCGCTCAAGCTG
CTTTCGGCGTCGGAGACTCGGCTCTGGTCGGAGGCGCCCATCACCTTGACCAACGTCGAGGATTCTGCGTCGCTG
ATCCTCGACTGCATCAAGCGCGGGCACGACGACGAGGACGTCAGCCGTTGCCAGGGACTGCCCGTCGCCAAGGGT
CGGAGCGTCGTGCTGCGCGTGTACGAGTCGCTGGGAGGCCGGAGCAGGGGTACAATCCGTACCAAACTGGGCGTG
AAGCGCGTCTTCAAGAGCAATTTGCTGGAGGACGAGCTGCACGAGATCAAGATTGTCGACGGAGAGTTTAGCATT
GAGTTGCGACCGTTTGAGGTGGCGACATACAAGCTGGCGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail