Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|423
Gene name
LocationContig_112:317..1899
Strand+
Gene length (bp)1582
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.0E-27 3 374
PF00083 Sugar_tr Sugar (and other) transporter 8.3E-10 29 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 5 431 5.0E-40
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 3 431 7.0E-40
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 4 436 7.0E-40
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 1 448 9.0E-38
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 1 437 5.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 5 431 5.0E-40
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 3 431 7.0E-40
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 4 436 7.0E-40
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 1 448 9.0E-38
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 1 437 5.0E-37
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 5 434 8.0E-37
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 1 437 2.0E-36
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 15 434 3.0E-36
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 5 435 1.0E-35
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 5 435 1.0E-35
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 5 434 4.0E-34
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 10 436 5.0E-34
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 5 436 5.0E-34
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 2 437 6.0E-34
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 5 409 7.0E-34
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 2 434 1.0E-32
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 5 434 7.0E-31
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 3 431 2.0E-30
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 18 453 4.0E-30
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 5 435 6.0E-30
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 2 438 1.0E-29
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 2 433 7.0E-29
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 2 433 2.0E-28
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 3 430 2.0E-28
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 3 430 6.0E-28
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 5 431 1.0E-27
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 3 435 3.0E-24
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 15 431 4.0E-19
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 3 186 2.0E-12
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 7 323 1.0E-09
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 16 167 1.0E-09
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 1 249 2.0E-09
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 12 169 2.0E-08
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 3 178 3.0E-08
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 7 323 3.0E-08
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 12 135 1.0E-06
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 6 394 6.0E-06
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 5 166 9.0E-06
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 220 394 1.0E-05
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 6 177 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 77 99 22
3 112 134 22
4 144 163 19
5 220 242 22
6 257 279 22
7 300 322 22
8 327 349 22
9 370 392 22
10 402 424 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|423
MNFNTSLYSNAIPGISKEFHVSEQAARCGAMIFLVMYAFGCELWAPWSEEFGRKPVLQASLFLVNLFQLPVALAP
NFASVMVGRALGGLSSAGGSVTLGMIADMWEADVQQYAVAYVVFSSVAGSVLGPIVGGFTETYLSWQWSIWVQLI
LGVVVQAIHLFTVPETRTTIMMNKIAKKRRAEGNPNIWGPDELVPFRDRFSAKEVLTTWLRPFKMFLTEPIVLVL
SLLSGFSDALIFMFIQSFGLVYKQWGFSTIDIGLAFIPIGIGYGIAWAAFIPAIRRNIKEREAKPNDERAQYESR
LWFLLYTAPCLPIGLIGFAWTIQGPPLHWIGSMIFAAIVGIANYAIYMATIDYMICAYGPYSASATGGNGWARDF
LAGVLTVPALPFFENIARGSGKSLSYASTILFAISFILVLAVYAIYFYGPQLRARSPFAQRLADARQENLNEGHR
GSISYDPGRRSSTASGVDRRFSQQHRFFGESRVTPRGTPRGTPAASRRPSMVNMTTKK*
Coding >Ophun1|423
ATGAACTTCAACACGTCGCTCTACTCCAACGCCATCCCCGGCATCTCGAAAGAGTTCCACGTCAGCGAGCAGGCA
GCCCGCTGCGGAGCCATGATCTTCCTCGTCATGTACGCCTTTGGCTGCGAGCTGTGGGCGCCCTGGTCGGAGGAG
TTTGGCCGGAAACCAGTCCTACAGGCATCTCTCTTCCTCGTCAACCTGTTCCAGCTGCCCGTCGCGCTGGCCCCC
AACTTTGCCTCCGTCATGGTGGGACGTGCTCTCGGAGGTCTGTCCTCGGCCGGTGGTTCCGTCACGCTCGGCATG
ATCGCCGATATGTGGGAGGCCGATGTTCAGCAGTATGCCGTTGCCTACGTCGTCTTCTCTTCCGTGGCCGGCTCG
GTGCTCGGTCCCATCGTCGGTGGCTTCACTGAGACCTACCTCTCCTGGCAGTGGTCTATCTGGGTGCAGCTCATC
CTGGGAGTCGTCGTCCAGGCCATTCACTTGTTCACGGTGCCCGAGACGCGGACGACCATCATGATGAACAAGATC
GCCAAGAAGCGTCGGGCTGAGGGAAACCCCAACATCTGGGGCCCCGACGAGCTGGTGCCCTTCCGCGACAGATTC
TCGGCCAAAGAGGTTCTCACCACCTGGCTCCGACCCTTCAAGATGTTCCTGACGGAGCCCATTGTGCTCGTCCTG
TCGCTTCTTTCGGGCTTCTCCGACGCCCTCATCTTCATGTTCATTCAGTCTTTCGGCCTCGTCTACAAGCAATGG
GGCTTCAGCACCATCGACATCGGCCTGGCTTTCATCCCCATCGGAATCGGCTATGGCATCGCCTGGGCTGCCTTT
ATACCGGCTATCCGCCGCAATATCAAGGAGCGTGAGGCCAAGCCCAACGACGAGCGCGCTCAGTACGAGTCCCGC
CTGTGGTTCCTCTTATACACGGCCCCTTGCCTGCCAATCGGCCTCATCGGCTTCGCTTGGACTATTCAAGGACCG
CCGCTGCACTGGATCGGCTCCATGATCTTCGCCGCCATCGTCGGCATCGCCAACTACGCCATTTACATGGCCACT
ATAGACTACATGATTTGCGCCTACGGACCCTATTCCGCTTCAGCCACCGGTGGCAACGGCTGGGCCCGAGACTTC
CTGGCCGGTGTCCTGACCGTTCCGGCTCTGCCCTTCTTTGAGAACATCGCCCGTGGCTCAGGCAAGAGTCTCAGT
TACGCCAGCACCATCCTGTTTGCCATCTCCTTTATTCTCGTTTTGGCTGTTTATGCCATCTACTTCTACGGCCCT
CAGCTGCGTGCCCGCTCGCCGTTTGCTCAGCGTCTGGCCGATGCTCGTCAAGAGAACCTCAACGAGGGCCACCGC
GGCAGCATCTCGTACGATCCGGGACGTCGATCCTCTACCGCCTCGGGCGTCGATCGCCGGTTCAGCCAACAACAC
CGCTTCTTCGGAGAGAGCCGTGTCACCCCCCGTGGCACGCCTCGCGGTACGCCCGCTGCCAGCCGACGGCCCAGC
ATGGTCAACATGACGACCAAGAAGTAG
Transcript >Ophun1|423
ATGAACTTCAACACGTCGCTCTACTCCAACGCCATCCCCGGCATCTCGAAAGAGTTCCACGTCAGCGAGCAGGCA
GCCCGCTGCGGAGCCATGATCTTCCTCGTCATGTACGCCTTTGGCTGCGAGCTGTGGGCGCCCTGGTCGGAGGAG
TTTGGCCGGAAACCAGTCCTACAGGCATCTCTCTTCCTCGTCAACCTGTTCCAGCTGCCCGTCGCGCTGGCCCCC
AACTTTGCCTCCGTCATGGTGGGACGTGCTCTCGGAGGTCTGTCCTCGGCCGGTGGTTCCGTCACGCTCGGCATG
ATCGCCGATATGTGGGAGGCCGATGTTCAGCAGTATGCCGTTGCCTACGTCGTCTTCTCTTCCGTGGCCGGCTCG
GTGCTCGGTCCCATCGTCGGTGGCTTCACTGAGACCTACCTCTCCTGGCAGTGGTCTATCTGGGTGCAGCTCATC
CTGGGAGTCGTCGTCCAGGCCATTCACTTGTTCACGGTGCCCGAGACGCGGACGACCATCATGATGAACAAGATC
GCCAAGAAGCGTCGGGCTGAGGGAAACCCCAACATCTGGGGCCCCGACGAGCTGGTGCCCTTCCGCGACAGATTC
TCGGCCAAAGAGGTTCTCACCACCTGGCTCCGACCCTTCAAGATGTTCCTGACGGAGCCCATTGTGCTCGTCCTG
TCGCTTCTTTCGGGCTTCTCCGACGCCCTCATCTTCATGTTCATTCAGTCTTTCGGCCTCGTCTACAAGCAATGG
GGCTTCAGCACCATCGACATCGGCCTGGCTTTCATCCCCATCGGAATCGGCTATGGCATCGCCTGGGCTGCCTTT
ATACCGGCTATCCGCCGCAATATCAAGGAGCGTGAGGCCAAGCCCAACGACGAGCGCGCTCAGTACGAGTCCCGC
CTGTGGTTCCTCTTATACACGGCCCCTTGCCTGCCAATCGGCCTCATCGGCTTCGCTTGGACTATTCAAGGACCG
CCGCTGCACTGGATCGGCTCCATGATCTTCGCCGCCATCGTCGGCATCGCCAACTACGCCATTTACATGGCCACT
ATAGACTACATGATTTGCGCCTACGGACCCTATTCCGCTTCAGCCACCGGTGGCAACGGCTGGGCCCGAGACTTC
CTGGCCGGTGTCCTGACCGTTCCGGCTCTGCCCTTCTTTGAGAACATCGCCCGTGGCTCAGGCAAGAGTCTCAGT
TACGCCAGCACCATCCTGTTTGCCATCTCCTTTATTCTCGTTTTGGCTGTTTATGCCATCTACTTCTACGGCCCT
CAGCTGCGTGCCCGCTCGCCGTTTGCTCAGCGTCTGGCCGATGCTCGTCAAGAGAACCTCAACGAGGGCCACCGC
GGCAGCATCTCGTACGATCCGGGACGTCGATCCTCTACCGCCTCGGGCGTCGATCGCCGGTTCAGCCAACAACAC
CGCTTCTTCGGAGAGAGCCGTGTCACCCCCCGTGGCACGCCTCGCGGTACGCCCGCTGCCAGCCGACGGCCCAGC
ATGGTCAACATGACGACCAAGAAGTAG
Gene >Ophun1|423
ATGAACTTCAACACGTCGCTCTACTCCAACGCCATCCCCGGCATCTCGAAAGAGTTCCACGTCAGCGAGCAGGCA
GCCCGCTGCGGAGCCATGATCTTCCTCGTCATGTACGCCTTTGGCTGCGAGCTGTGGGCGCCCTGGTCGGAGGAG
TTTGGCCGGAAACCAGTCCTACAGGCATCTCTCTTCCTCGTCAACCTGTTCCAGCTGCCCGTCGCGCTGGCCCCC
AACTTTGCCTCCGTCATGGTGGGACGTGCTCTCGGAGGTCTGTCCTCGGCCGGTGGTTCCGTCACGCTCGGCATG
ATCGCCGATATGTGGGAGGCCGATGTTCAGCAGTATGCCGTTGCCTACGTCGTCTTCTCTTCCGTGGCCGGCTCG
GTGCTCGGTCCCATCGTCGGTGGCTTCACTGAGACCTACCTCTCCTGGCAGTGGTCTATCTGGGTGCAGCTCATC
CTGGGAGTCGTCGTCCAGGCCATTCACTTGTTCACGGTGCCCGAGACGCGGACGACCATCATGATGAACAAGATC
GCCAAGAAGCGTCGGGCTGAGGGAAACCCCAACATCTGGGGCCCCGACGAGCTGGTGCCCTTCCGCGACAGATTC
TCGGCCAAAGAGGTTCTCACCACCTGGCTCCGACCCTTCAAGATGTTCCTGACGGAGCCCATTGTGCTCGTCCTG
TCGCTTCTTTCGGGCTTCTCCGACGCCCTCATCTTCATGTTCATTCAGTCTTTCGGCCTCGTCTACAAGCAATGG
GGCTTCAGCACCATCGACATCGGCCTGGCTTTCATCCCCATCGGAATCGGCTATGGCATCGCCTGGGCTGCCTTT
ATACCGGCTATCCGCCGCAATATCAAGGAGCGTGAGGCCAAGCCCAACGACGAGCGCGCTCAGTACGAGTCCCGC
CTGTGGTTCCTCTTATACACGGCCCCTTGCCTGCCAATCGGCCTCATCGGCTTCGCTTGGACTATTCAAGGACCG
CCGCTGCACTGGATCGGCTCCATGATCTTCGCCGCCATCGTCGGCATCGCCAACTACGCCATTTACATGGCCACT
ATAGACTACATGATTTGCGCCTACGGACCCTATTCCGCTTCAGCCACCGGTGGCAACGGCTGGGCCCGAGACTTC
CTGGCCGGTGTCCTGACCGTTCCGGCTCTGCCCTTCTTTGAGAACATCGCCCGTGGCTCAGGCAAGAGTCTCAGT
TACGCCAGCACCATCCTGTTTGCCATCTCCTTTATTCTCGTTTTGGCTGTTTATGCCATCTACTTCTACGGCCCT
CAGCTGCGTGCCCGCTCGCCGTTTGCTCAGCGTCTGGCCGATGCTCGTCAAGAGAACCTCAACGAGGGCCACCGC
GGCAGCATCTCGTACGATCCGGGACGTCGATGTGAGTCTTGTTCTTCCTTCCACCCCCTGTATCTCGCTGACGAT
GCCTCTTCCAGCCTCTACCGCCTCGGGCGTCGATCGCCGGTTCAGCCAACAACACCGCTTCTTCGGAGAGAGCCG
TGTCACCCCCCGTGGCACGCCTCGCGGTACGCCCGCTGCCAGCCGACGGCCCAGCATGGTCAACATGACGACCAA
GAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail