Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4228
Gene name
LocationContig_39:20979..22455
Strand+
Gene length (bp)1476
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00202 Aminotran_3 Aminotransferase class-III 4.6E-106 71 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3I3|ARGD_NEUCR Acetylornithine aminotransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-8 PE=3 SV=1 37 451 0.0E+00
sp|Q6C846|ARGD_YARLI Acetylornithine aminotransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARG8 PE=3 SV=1 60 451 2.0E-151
sp|Q6BUP9|ARGD_DEBHA Acetylornithine aminotransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARG8 PE=3 SV=1 7 451 6.0E-143
sp|P18544|ARGD_YEAST Acetylornithine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG8 PE=1 SV=1 54 451 2.0E-133
sp|O14433|ARGD_KLULA Acetylornithine aminotransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARG8 PE=3 SV=2 60 450 3.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3I3|ARGD_NEUCR Acetylornithine aminotransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-8 PE=3 SV=1 37 451 0.0E+00
sp|Q6C846|ARGD_YARLI Acetylornithine aminotransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARG8 PE=3 SV=1 60 451 2.0E-151
sp|Q6BUP9|ARGD_DEBHA Acetylornithine aminotransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARG8 PE=3 SV=1 7 451 6.0E-143
sp|P18544|ARGD_YEAST Acetylornithine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG8 PE=1 SV=1 54 451 2.0E-133
sp|O14433|ARGD_KLULA Acetylornithine aminotransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARG8 PE=3 SV=2 60 450 3.0E-132
sp|Q75AW1|ARGD_ASHGO Acetylornithine aminotransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARG8 PE=3 SV=1 50 447 4.0E-129
sp|Q6FXA4|ARGD_CANGA Acetylornithine aminotransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARG8 PE=3 SV=1 45 450 5.0E-126
sp|O74548|ARGD_SCHPO Probable acetylornithine aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg1 PE=2 SV=1 32 447 6.0E-126
sp|Q55DT8|ARGD_DICDI Probable acetylornithine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=argD PE=3 SV=1 43 447 7.0E-109
sp|Q9X2A5|ARGD_THEMA Acetylornithine aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argD PE=1 SV=1 60 447 1.0E-104
sp|Q58131|ARGD_METJA Acetylornithine aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argD PE=3 SV=1 60 451 4.0E-102
sp|Q8R7C1|ARGD_CALS4 Acetylornithine aminotransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argD PE=3 SV=1 53 455 5.0E-99
sp|O66442|ARGD_AQUAE Acetylornithine aminotransferase OS=Aquifex aeolicus (strain VF5) GN=argD PE=1 SV=1 60 449 2.0E-98
sp|Q97GH9|ARGD_CLOAB Acetylornithine aminotransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argD PE=3 SV=1 60 450 6.0E-98
sp|A7FIL6|ASTC_YERP3 Succinylornithine transaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=astC PE=3 SV=1 60 447 7.0E-97
sp|A1JS45|ASTC_YERE8 Succinylornithine transaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=astC PE=3 SV=1 60 447 1.0E-96
sp|Q66B21|ASTC_YERPS Succinylornithine transaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=astC PE=3 SV=1 60 444 2.0E-96
sp|A9QZ63|ASTC_YERPG Succinylornithine transaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=astC PE=3 SV=1 60 447 2.0E-96
sp|Q8D0D7|ASTC_YERPE Succinylornithine transaminase OS=Yersinia pestis GN=astC PE=3 SV=2 60 447 2.0E-96
sp|Q1C8B1|ASTC_YERPA Succinylornithine transaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=astC PE=3 SV=1 60 447 2.0E-96
sp|P73133|ARGD_SYNY3 Acetylornithine aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argD PE=3 SV=1 55 452 3.0E-96
sp|Q9CNT1|ARGD_PASMU Acetylornithine aminotransferase OS=Pasteurella multocida (strain Pm70) GN=argD PE=3 SV=1 61 453 2.0E-95
sp|P54752|ARGD_NOSS1 Acetylornithine aminotransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argD PE=3 SV=1 61 452 5.0E-94
sp|Q9M8M7|ARGD_ARATH Acetylornithine aminotransferase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=WIN1 PE=1 SV=1 48 449 8.0E-94
sp|Q87DM8|ARGD_XYLFT Acetylornithine aminotransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=argD PE=3 SV=1 60 444 2.0E-93
sp|O04866|ARGD_ALNGL Acetylornithine aminotransferase, mitochondrial OS=Alnus glutinosa GN=AG118 PE=2 SV=1 45 447 9.0E-93
sp|Q9PDF2|ARGD_XYLFA Acetylornithine aminotransferase OS=Xylella fastidiosa (strain 9a5c) GN=argD PE=3 SV=1 60 444 2.0E-92
sp|P59323|ARGD_VIBVU Acetylornithine aminotransferase OS=Vibrio vulnificus (strain CMCP6) GN=argD PE=3 SV=1 61 452 4.0E-92
sp|Q7MH19|ARGD_VIBVY Acetylornithine aminotransferase OS=Vibrio vulnificus (strain YJ016) GN=argD PE=3 SV=1 61 452 4.0E-92
sp|P59322|ARGD_THEEB Acetylornithine aminotransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=argD PE=3 SV=1 61 452 6.0E-92
sp|B5YQ35|ASTC_ECO5E Succinylornithine transaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=astC PE=3 SV=1 60 456 1.0E-91
sp|Q8X598|ASTC_ECO57 Succinylornithine transaminase OS=Escherichia coli O157:H7 GN=astC PE=3 SV=1 60 456 1.0E-91
sp|B7USC9|ASTC_ECO27 Succinylornithine transaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=astC PE=3 SV=1 60 445 1.0E-91
sp|Q3Z295|ASTC_SHISS Succinylornithine transaminase OS=Shigella sonnei (strain Ss046) GN=astC PE=3 SV=1 60 445 1.0E-91
sp|P30900|ARGD_RHOCB Acetylornithine aminotransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=argD PE=3 SV=2 61 440 1.0E-91
sp|B7L6M2|ASTC_ECO55 Succinylornithine transaminase OS=Escherichia coli (strain 55989 / EAEC) GN=astC PE=3 SV=1 60 445 2.0E-91
sp|Q1RB45|ASTC_ECOUT Succinylornithine transaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=astC PE=3 SV=1 60 445 6.0E-91
sp|Q8FGZ9|ASTC_ECOL6 Succinylornithine transaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=astC PE=3 SV=1 60 445 6.0E-91
sp|Q0TH82|ASTC_ECOL5 Succinylornithine transaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=astC PE=3 SV=1 60 445 6.0E-91
sp|A1ABS9|ASTC_ECOK1 Succinylornithine transaminase OS=Escherichia coli O1:K1 / APEC GN=astC PE=3 SV=1 60 445 6.0E-91
sp|B7MVM7|ASTC_ECO81 Succinylornithine transaminase OS=Escherichia coli O81 (strain ED1a) GN=astC PE=3 SV=1 60 445 6.0E-91
sp|B7MAV9|ASTC_ECO45 Succinylornithine transaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=astC PE=3 SV=1 60 445 6.0E-91
sp|A8A0U0|ASTC_ECOHS Succinylornithine transaminase OS=Escherichia coli O9:H4 (strain HS) GN=astC PE=3 SV=1 60 445 6.0E-91
sp|B7LQ44|ASTC_ESCF3 Succinylornithine transaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=astC PE=3 SV=1 60 445 8.0E-91
sp|Q9K8V5|ARGD_BACHD Acetylornithine aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argD PE=3 SV=1 60 440 1.0E-90
sp|B6IBG8|ASTC_ECOSE Succinylornithine transaminase OS=Escherichia coli (strain SE11) GN=astC PE=3 SV=1 60 445 1.0E-90
sp|P77581|ASTC_ECOLI Succinylornithine transaminase OS=Escherichia coli (strain K12) GN=astC PE=1 SV=1 60 445 1.0E-90
sp|B1IPI2|ASTC_ECOLC Succinylornithine transaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=astC PE=3 SV=1 60 445 1.0E-90
sp|B1XGK9|ASTC_ECODH Succinylornithine transaminase OS=Escherichia coli (strain K12 / DH10B) GN=astC PE=3 SV=1 60 445 1.0E-90
sp|C4ZZA4|ASTC_ECOBW Succinylornithine transaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=astC PE=3 SV=1 60 445 1.0E-90
sp|B7M1G0|ASTC_ECO8A Succinylornithine transaminase OS=Escherichia coli O8 (strain IAI1) GN=astC PE=3 SV=1 60 445 1.0E-90
sp|A7ZML6|ASTC_ECO24 Succinylornithine transaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=astC PE=3 SV=1 60 445 1.0E-90
sp|B7N584|ASTC_ECOLU Succinylornithine transaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=astC PE=3 SV=1 60 445 1.0E-90
sp|Q87L20|ARGD_VIBPA Acetylornithine aminotransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argD PE=3 SV=1 61 452 2.0E-90
sp|B1LDY3|ASTC_ECOSM Succinylornithine transaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=astC PE=3 SV=1 60 445 3.0E-90
sp|Q321P0|ASTC_SHIBS Succinylornithine transaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=astC PE=3 SV=1 60 445 4.0E-90
sp|B2U3D0|ASTC_SHIB3 Succinylornithine transaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=astC PE=3 SV=1 60 445 4.0E-90
sp|Q7NN66|ARGD_GLOVI Acetylornithine aminotransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=argD PE=3 SV=2 60 452 5.0E-90
sp|A8AHE0|ASTC_CITK8 Succinylornithine transaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=astC PE=3 SV=1 60 445 5.0E-90
sp|B7NT29|ASTC_ECO7I Succinylornithine transaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=astC PE=3 SV=1 60 445 5.0E-90
sp|P59319|ARGD_PSEPK Acetylornithine aminotransferase OS=Pseudomonas putida (strain KT2440) GN=argD PE=3 SV=1 55 456 7.0E-90
sp|Q8PH31|ARGD_XANAC Acetylornithine aminotransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=argD PE=3 SV=1 46 447 1.0E-89
sp|P59320|ARGD_SHEON Acetylornithine aminotransferase OS=Shewanella oneidensis (strain MR-1) GN=argD PE=3 SV=1 55 444 5.0E-89
sp|Q7V0G0|ARGD_PROMP Acetylornithine aminotransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argD PE=3 SV=2 59 451 1.0E-88
sp|Q9KNW2|ARGD_VIBCH Acetylornithine aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argD PE=3 SV=1 61 452 3.0E-87
sp|Q9PIR7|ARGD_CAMJE Acetylornithine aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argD PE=1 SV=2 60 451 4.0E-87
sp|Q5HP24|ARGD_STAEQ Acetylornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argD PE=3 SV=1 60 449 5.0E-87
sp|B4T3Z4|ASTC_SALNS Succinylornithine transaminase OS=Salmonella newport (strain SL254) GN=astC PE=3 SV=1 60 445 8.0E-87
sp|Q7N2G7|ASTC_PHOLL Succinylornithine transaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=astC PE=3 SV=1 56 444 1.0E-86
sp|Q8CSG1|ARGD_STAES Acetylornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argD PE=3 SV=2 60 449 1.0E-86
sp|B5BA72|ASTC_SALPK Succinylornithine transaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=astC PE=3 SV=1 60 445 2.0E-86
sp|Q5PHC8|ASTC_SALPA Succinylornithine transaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=astC PE=3 SV=1 60 445 2.0E-86
sp|Q8Z6F9|ASTC_SALTI Succinylornithine transaminase OS=Salmonella typhi GN=astC PE=3 SV=1 60 445 3.0E-86
sp|Q8X4S6|ARGD_ECO57 Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli O157:H7 GN=argD PE=3 SV=3 61 456 4.0E-86
sp|B5RB01|ASTC_SALG2 Succinylornithine transaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=astC PE=3 SV=1 60 445 5.0E-86
sp|B5QWJ0|ASTC_SALEP Succinylornithine transaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=astC PE=3 SV=1 60 445 5.0E-86
sp|P18335|ARGD_ECOLI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli (strain K12) GN=argD PE=1 SV=4 61 456 5.0E-86
sp|Q8ZPV2|ASTC_SALTY Succinylornithine transaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=astC PE=2 SV=1 60 445 5.0E-86
sp|A9N278|ASTC_SALPB Succinylornithine transaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=astC PE=3 SV=1 60 445 6.0E-86
sp|Q8CUM9|ARGD_OCEIH Acetylornithine aminotransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argD PE=3 SV=1 61 449 6.0E-86
sp|B5FJD8|ASTC_SALDC Succinylornithine transaminase OS=Salmonella dublin (strain CT_02021853) GN=astC PE=3 SV=1 60 445 8.0E-86
sp|C0Q6X9|ASTC_SALPC Succinylornithine transaminase OS=Salmonella paratyphi C (strain RKS4594) GN=astC PE=3 SV=1 60 445 8.0E-86
sp|B4TGE0|ASTC_SALHS Succinylornithine transaminase OS=Salmonella heidelberg (strain SL476) GN=astC PE=3 SV=1 60 445 8.0E-86
sp|B5F846|ASTC_SALA4 Succinylornithine transaminase OS=Salmonella agona (strain SL483) GN=astC PE=3 SV=1 60 445 8.0E-86
sp|P59317|ARGD_ECOL6 Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argD PE=3 SV=2 61 456 1.0E-85
sp|O30156|ARGD_ARCFU Acetylornithine aminotransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argD PE=3 SV=1 60 447 2.0E-85
sp|Q885K0|ARGD1_PSESM Acetylornithine aminotransferase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argD1 PE=3 SV=1 55 452 3.0E-85
sp|Q57PX9|ASTC_SALCH Succinylornithine transaminase OS=Salmonella choleraesuis (strain SC-B67) GN=astC PE=3 SV=1 60 445 4.0E-85
sp|Q8P5Q4|ARGD_XANCP Acetylornithine aminotransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=argD PE=3 SV=1 46 452 4.0E-85
sp|Q7VAS9|ARGD_PROMA Acetylornithine aminotransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argD PE=3 SV=2 60 451 5.0E-85
sp|P57600|ARGD_BUCAI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argD PE=3 SV=1 61 445 6.0E-85
sp|Q7N9E5|ARGD_PHOLL Acetylornithine/succinyldiaminopimelate aminotransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argD PE=3 SV=1 61 447 9.0E-85
sp|Q8Z1Z3|ARGD_SALTI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Salmonella typhi GN=argD PE=3 SV=3 61 450 1.0E-84
sp|O27392|ARGD_METTH Acetylornithine aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argD PE=3 SV=1 60 452 1.0E-84
sp|Q98BB7|ARGD_RHILO Acetylornithine aminotransferase OS=Rhizobium loti (strain MAFF303099) GN=argD PE=3 SV=1 58 440 2.0E-84
sp|Q92BC0|ARGD_LISIN Acetylornithine aminotransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argD PE=3 SV=1 60 447 3.0E-84
sp|Q71Z79|ARGD_LISMF Acetylornithine aminotransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argD PE=3 SV=1 60 447 4.0E-84
sp|P59321|ARGD_SHIFL Acetylornithine/succinyldiaminopimelate aminotransferase OS=Shigella flexneri GN=argD PE=3 SV=1 61 456 5.0E-84
sp|P40732|ARGD_SALTY Acetylornithine/succinyldiaminopimelate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argD PE=1 SV=3 61 450 5.0E-84
sp|Q8UI71|ARGD_AGRFC Acetylornithine aminotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argD PE=3 SV=1 54 444 6.0E-84
sp|Q8Y6U4|ARGD_LISMO Acetylornithine aminotransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argD PE=3 SV=1 60 447 3.0E-83
sp|P59086|ARGD_BUCAP Acetylornithine/succinyldiaminopimelate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argD PE=3 SV=1 73 445 8.0E-83
sp|Q9JYY4|ARGD_NEIMB Acetylornithine aminotransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argD PE=3 SV=1 60 454 1.0E-82
sp|Q9AAL3|ARGD1_CAUCR Acetylornithine aminotransferase 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argD1 PE=3 SV=1 61 440 1.0E-82
sp|Q59928|ARGD_STRMU Acetylornithine aminotransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argD PE=3 SV=2 61 451 2.0E-82
sp|Q9JTX9|ARGD_NEIMA Acetylornithine aminotransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argD PE=3 SV=1 60 447 2.0E-82
sp|O30508|ARUC_PSEAE Succinylornithine transaminase/acetylornithine aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruC PE=1 SV=2 55 456 8.0E-82
sp|P59324|ARGD_YERPE Acetylornithine/succinyldiaminopimelate aminotransferase OS=Yersinia pestis GN=argD PE=3 SV=2 61 452 1.0E-81
sp|Q92SA0|ARGD_RHIME Acetylornithine aminotransferase OS=Rhizobium meliloti (strain 1021) GN=argD PE=3 SV=1 64 439 2.0E-81
sp|Q7V8L1|ARGD_PROMM Acetylornithine aminotransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=argD PE=3 SV=1 61 440 1.0E-80
sp|Q8TUZ5|ARGD_METKA Acetylornithine aminotransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argD PE=3 SV=1 60 451 9.0E-80
sp|P63567|ARGD_BRUSU Acetylornithine aminotransferase OS=Brucella suis biovar 1 (strain 1330) GN=argD PE=3 SV=1 64 439 1.0E-79
sp|P63566|ARGD_BRUME Acetylornithine aminotransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argD PE=3 SV=1 64 439 1.0E-79
sp|Q89VE9|ARGD1_BRADU Acetylornithine aminotransferase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argD1 PE=3 SV=1 59 440 4.0E-79
sp|Q7SI94|ARGD_SULSO Acetylornithine/acetyl-lysine aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argD PE=3 SV=2 72 440 3.0E-78
sp|P59318|ARGD_MYXXA Acetylornithine aminotransferase OS=Myxococcus xanthus GN=argD PE=3 SV=1 53 440 4.0E-78
sp|Q8XWN8|ARGD_RALSO Acetylornithine aminotransferase OS=Ralstonia solanacearum (strain GMI1000) GN=argD PE=3 SV=1 67 440 1.0E-77
sp|Q9CHD3|ARGD_LACLA Acetylornithine aminotransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argD PE=3 SV=1 61 447 1.0E-77
sp|Q81M98|ARGD_BACAN Acetylornithine aminotransferase OS=Bacillus anthracis GN=argD PE=3 SV=1 60 440 5.0E-76
sp|Q8TUE8|ARGD_METAC Acetylornithine aminotransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argD PE=3 SV=2 41 450 1.0E-75
sp|Q5JFW3|ARGD_THEKO Acetylornithine aminotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argD PE=3 SV=1 72 436 3.0E-75
sp|Q7VSH3|ARGD2_BORPE Acetylornithine aminotransferase 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argD2 PE=3 SV=1 61 455 3.0E-75
sp|Q818W2|ARGD_BACCR Acetylornithine aminotransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argD PE=3 SV=2 60 440 5.0E-75
sp|P59316|ARGD_CHLTE Acetylornithine aminotransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argD PE=3 SV=1 64 451 6.0E-75
sp|Q7U5R5|ARGD_SYNPX Acetylornithine aminotransferase OS=Synechococcus sp. (strain WH8102) GN=argD PE=3 SV=1 57 440 6.0E-75
sp|Q7WDN7|ARGD2_BORBR Acetylornithine aminotransferase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argD2 PE=3 SV=1 61 455 7.0E-75
sp|Q07907|ARGD_GEOSE Acetylornithine aminotransferase OS=Geobacillus stearothermophilus GN=argD PE=3 SV=2 61 447 6.0E-74
sp|Q7W2N9|ARGD2_BORPA Acetylornithine aminotransferase 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argD2 PE=3 SV=1 61 455 1.0E-73
sp|P36839|ARGD_BACSU Acetylornithine aminotransferase OS=Bacillus subtilis (strain 168) GN=argD PE=3 SV=2 61 452 1.0E-73
sp|Q7MAE6|ARGD_WOLSU Acetylornithine aminotransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argD PE=3 SV=2 60 451 2.0E-73
sp|Q9A652|ARGD2_CAUCR Acetylornithine aminotransferase 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argD2 PE=3 SV=1 60 439 6.0E-73
sp|Q5SHH5|ARGD_THET8 Acetylornithine/acetyl-lysine aminotransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argD PE=1 SV=1 71 440 1.0E-72
sp|Q8U0B4|ARGD_PYRFU Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argD PE=3 SV=1 72 440 2.0E-72
sp|Q8PX16|ARGD_METMA Acetylornithine aminotransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argD PE=3 SV=1 52 450 4.0E-72
sp|Q93R93|ARGD_THET2 Acetylornithine/acetyl-lysine aminotransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argD PE=1 SV=1 71 440 4.0E-72
sp|Q82UP3|ARGD_NITEU Acetylornithine aminotransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argD PE=3 SV=1 60 439 9.0E-72
sp|Q9V1I4|ARGD_PYRAB Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argD PE=3 SV=1 72 446 1.0E-71
sp|Q89LG2|ARGD2_BRADU Acetylornithine aminotransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argD2 PE=3 SV=1 59 447 1.0E-71
sp|O59401|ARGD_PYRHO Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argD PE=3 SV=1 72 438 2.0E-71
sp|Q7WKW5|ARGD1_BORBR Acetylornithine aminotransferase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argD1 PE=3 SV=1 65 439 4.0E-71
sp|Q7VTJ7|ARGD1_BORPE Acetylornithine aminotransferase 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argD1 PE=3 SV=1 65 439 1.0E-70
sp|Q882K8|ARGD2_PSESM Acetylornithine aminotransferase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argD2 PE=3 SV=1 61 440 1.0E-70
sp|Q7W7H6|ARGD1_BORPA Acetylornithine aminotransferase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argD1 PE=3 SV=2 65 439 3.0E-70
sp|Q976K0|ARGD_SULTO Acetylornithine/acetyl-lysine aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argD PE=3 SV=1 72 440 6.0E-70
sp|Q7VMS5|ARGD_HAEDU Acetylornithine aminotransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argD PE=3 SV=2 60 452 8.0E-70
sp|P24087|ARGD_LEPIN Acetylornithine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argD PE=3 SV=2 54 447 1.0E-69
sp|Q72RH8|ARGD_LEPIC Acetylornithine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argD PE=3 SV=1 54 447 1.0E-69
sp|Q59282|ARGD_CORGL Acetylornithine aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argD PE=3 SV=2 61 452 6.0E-67
sp|Q8ZV07|ARGD_PYRAE Acetylornithine/acetyl-lysine aminotransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argD PE=3 SV=1 62 442 2.0E-66
sp|A0QYS9|ARGD_MYCS2 Acetylornithine aminotransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=argD PE=1 SV=1 61 440 1.0E-65
sp|Q8FTN2|ARGD_COREF Acetylornithine aminotransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argD PE=3 SV=1 61 440 6.0E-65
sp|Q9CC12|ARGD_MYCLE Acetylornithine aminotransferase OS=Mycobacterium leprae (strain TN) GN=argD PE=3 SV=1 61 440 4.0E-63
sp|O08321|ARGD_LACPL Acetylornithine aminotransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argD PE=3 SV=4 60 449 5.0E-62
sp|P9WPZ7|ARGD_MYCTU Acetylornithine aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=argD PE=1 SV=1 61 440 2.0E-61
sp|P9WPZ6|ARGD_MYCTO Acetylornithine aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=argD PE=3 SV=1 61 440 2.0E-61
sp|P63569|ARGD_MYCBO Acetylornithine aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=argD PE=3 SV=1 61 440 2.0E-61
sp|B9DIU0|OAT_STACT Ornithine aminotransferase OS=Staphylococcus carnosus (strain TM300) GN=rocD PE=3 SV=1 48 452 4.0E-60
sp|Q6GKC1|OAT1_STAAR Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MRSA252) GN=rocD1 PE=3 SV=1 60 440 7.0E-60
sp|Q8NYM5|OAT1_STAAW Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MW2) GN=rocD1 PE=3 SV=1 60 440 2.0E-59
sp|Q6GCU1|OAT1_STAAS Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MSSA476) GN=rocD1 PE=3 SV=1 60 440 2.0E-59
sp|Q5HJI8|OAT1_STAAC Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain COL) GN=rocD1 PE=3 SV=1 60 440 2.0E-59
sp|P60296|OAT1_STAAN Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain N315) GN=rocD1 PE=3 SV=1 60 440 2.0E-59
sp|P60295|OAT1_STAAM Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocD1 PE=3 SV=1 60 440 2.0E-59
sp|P49724|OAT_DROAN Ornithine aminotransferase, mitochondrial OS=Drosophila ananassae GN=Oat PE=1 SV=1 24 447 1.0E-58
sp|Q18040|OAT_CAEEL Probable ornithine aminotransferase, mitochondrial OS=Caenorhabditis elegans GN=C16A3.10 PE=3 SV=3 67 447 1.0E-58
sp|P60299|OAT2_STAAW Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MW2) GN=rocD2 PE=3 SV=1 60 451 2.0E-58
sp|Q6GAW9|OAT2_STAAS Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MSSA476) GN=rocD2 PE=3 SV=1 60 451 2.0E-58
sp|P60298|OAT2_STAAN Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain N315) GN=rocD2 PE=1 SV=1 60 451 2.0E-58
sp|P60297|OAT2_STAAM Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocD2 PE=3 SV=1 60 451 2.0E-58
sp|Q5HHC8|OAT2_STAAC Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain COL) GN=rocD2 PE=3 SV=1 60 451 2.0E-58
sp|Q6GID1|OAT2_STAAR Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MRSA252) GN=rocD2 PE=3 SV=1 60 451 6.0E-58
sp|Q10G56|OAT_ORYSJ Ornithine aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica GN=OAT PE=2 SV=1 64 440 2.0E-57
sp|Q07805|OAT_PLAFD Ornithine aminotransferase OS=Plasmodium falciparum (isolate CDC / Honduras) GN=OAT PE=1 SV=1 60 447 2.0E-57
sp|Q6LFH8|OAT_PLAF7 Ornithine aminotransferase OS=Plasmodium falciparum (isolate 3D7) GN=OAT PE=1 SV=1 60 447 2.0E-57
sp|Q828A3|ARGD_STRAW Acetylornithine aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argD PE=3 SV=1 61 456 3.0E-57
sp|Q9RW75|ARGD_DEIRA Acetylornithine/acetyl-lysine aminotransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argD PE=3 SV=2 54 440 5.0E-57
sp|Q8CT82|OAT_STAES Ornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rocD PE=3 SV=1 60 452 7.0E-57
sp|Q5HQK4|OAT_STAEQ Ornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rocD PE=3 SV=1 60 452 8.0E-57
sp|Q9L1A4|ARGD_STRCO Acetylornithine aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argD PE=3 SV=1 61 440 9.0E-57
sp|Q9VW26|OAT_DROME Ornithine aminotransferase, mitochondrial OS=Drosophila melanogaster GN=Oat PE=2 SV=1 48 447 1.0E-56
sp|Q7VSA0|OAT_BORPE Ornithine aminotransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rocD PE=3 SV=2 71 440 2.0E-56
sp|Q7W1E4|OAT_BORPA Ornithine aminotransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rocD PE=3 SV=3 71 440 2.0E-56
sp|Q7WP51|OAT_BORBR Ornithine aminotransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rocD PE=3 SV=2 71 440 2.0E-56
sp|P59315|ARGD_BIFLO Acetylornithine aminotransferase OS=Bifidobacterium longum (strain NCC 2705) GN=argD PE=3 SV=1 54 447 3.0E-56
sp|Q4A0N2|OAT1_STAS1 Ornithine aminotransferase 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocD1 PE=3 SV=1 60 451 3.0E-56
sp|Q9K5Z2|OAT_BACHD Ornithine aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rocD PE=3 SV=2 48 445 6.0E-56
sp|A7MIU0|PAT_CROS8 Putrescine aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=patA PE=3 SV=2 80 439 8.0E-56
sp|B9EAM9|OAT_MACCJ Ornithine aminotransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=rocD PE=3 SV=1 60 452 1.0E-55
sp|Q49W96|OAT2_STAS1 Ornithine aminotransferase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocD2 PE=3 SV=1 48 451 1.0E-55
sp|P29758|OAT_MOUSE Ornithine aminotransferase, mitochondrial OS=Mus musculus GN=Oat PE=1 SV=1 49 451 3.0E-55
sp|Q6D6Y6|PAT_PECAS Putrescine aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=patA PE=3 SV=1 80 455 4.0E-55
sp|C4L2E7|OAT_EXISA Ornithine aminotransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rocD PE=3 SV=1 64 452 6.0E-55
sp|Q9FNK4|OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=DELTA-OAT PE=1 SV=1 64 453 6.0E-55
sp|Q8EP32|OAT_OCEIH Ornithine aminotransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rocD PE=3 SV=1 50 451 7.0E-55
sp|Q4XWV5|OAT_PLACH Ornithine aminotransferase OS=Plasmodium chabaudi GN=OAT PE=3 SV=1 60 447 1.0E-54
sp|A8A4N0|PAT_ECOHS Putrescine aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=patA PE=3 SV=2 75 455 1.0E-54
sp|P42588|PAT_ECOLI Putrescine aminotransferase OS=Escherichia coli (strain K12) GN=patA PE=1 SV=2 75 455 1.0E-54
sp|B1XG77|PAT_ECODH Putrescine aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=patA PE=3 SV=2 75 455 1.0E-54
sp|C4ZQY9|PAT_ECOBW Putrescine aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=patA PE=3 SV=1 75 455 1.0E-54
sp|B7ND61|PAT_ECOLU Putrescine aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=patA PE=3 SV=2 80 455 2.0E-54
sp|B9ITF9|OAT_BACCQ Ornithine aminotransferase OS=Bacillus cereus (strain Q1) GN=rocD PE=3 SV=1 60 440 2.0E-54
sp|Q31WW1|PAT_SHIBS Putrescine aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=patA PE=3 SV=2 75 455 2.0E-54
sp|C5D6R2|OAT_GEOSW Ornithine aminotransferase OS=Geobacillus sp. (strain WCH70) GN=rocD PE=3 SV=1 60 452 2.0E-54
sp|P04181|OAT_HUMAN Ornithine aminotransferase, mitochondrial OS=Homo sapiens GN=OAT PE=1 SV=1 60 449 2.0E-54
sp|Q81GP2|OAT_BACCR Ornithine aminotransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rocD PE=3 SV=1 60 440 2.0E-54
sp|Q1R6Q7|PAT_ECOUT Putrescine aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=patA PE=3 SV=2 80 455 3.0E-54
sp|B6I445|PAT_ECOSE Putrescine aminotransferase OS=Escherichia coli (strain SE11) GN=patA PE=3 SV=2 80 455 3.0E-54
sp|A1AFZ3|PAT_ECOK1 Putrescine aminotransferase OS=Escherichia coli O1:K1 / APEC GN=patA PE=3 SV=2 80 455 3.0E-54
sp|B7N0M2|PAT_ECO81 Putrescine aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=patA PE=3 SV=2 80 455 3.0E-54
sp|B5YRB3|PAT_ECO5E Putrescine aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=patA PE=3 SV=1 80 455 3.0E-54
sp|Q8XAN1|PAT_ECO57 Putrescine aminotransferase OS=Escherichia coli O157:H7 GN=patA PE=3 SV=2 80 455 3.0E-54
sp|B7LH08|PAT_ECO55 Putrescine aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=patA PE=3 SV=2 80 455 3.0E-54
sp|B7MB08|PAT_ECO45 Putrescine aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=patA PE=3 SV=2 80 455 3.0E-54
sp|B7UIY0|PAT_ECO27 Putrescine aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=patA PE=3 SV=1 80 455 3.0E-54
sp|A7ZRV6|PAT_ECO24 Putrescine aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=patA PE=3 SV=2 80 455 3.0E-54
sp|C1EL61|OAT_BACC3 Ornithine aminotransferase OS=Bacillus cereus (strain 03BB102) GN=rocD PE=3 SV=1 60 440 3.0E-54
sp|Q8FDF5|PAT_ECOL6 Putrescine aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=patA PE=3 SV=2 80 455 3.0E-54
sp|B7LQF8|PAT_ESCF3 Putrescine aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=patA PE=3 SV=2 80 455 4.0E-54
sp|B7NJT8|PAT_ECO7I Putrescine aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=patA PE=3 SV=2 75 455 5.0E-54
sp|B1IRP4|PAT_ECOLC Putrescine aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=patA PE=3 SV=2 80 455 5.0E-54
sp|Q0TD34|PAT_ECOL5 Putrescine aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=patA PE=3 SV=2 80 455 6.0E-54
sp|P04182|OAT_RAT Ornithine aminotransferase, mitochondrial OS=Rattus norvegicus GN=Oat PE=1 SV=1 45 451 6.0E-54
sp|B1LF65|PAT_ECOSM Putrescine aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=patA PE=3 SV=2 80 455 6.0E-54
sp|B7LZM2|PAT_ECO8A Putrescine aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=patA PE=3 SV=2 80 455 7.0E-54
sp|Q83JJ8|PAT_SHIFL Putrescine aminotransferase OS=Shigella flexneri GN=patA PE=3 SV=5 80 455 1.0E-53
sp|Q0T0J2|PAT_SHIF8 Putrescine aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=patA PE=3 SV=1 80 455 1.0E-53
sp|Q81TV3|OAT_BACAN Ornithine aminotransferase OS=Bacillus anthracis GN=rocD PE=1 SV=1 60 440 1.0E-53
sp|C3LBX0|OAT_BACAC Ornithine aminotransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rocD PE=3 SV=1 60 440 1.0E-53
sp|C3P3K3|OAT_BACAA Ornithine aminotransferase OS=Bacillus anthracis (strain A0248) GN=rocD PE=3 SV=1 60 440 1.0E-53
sp|P38021|OAT_BACSU Ornithine aminotransferase OS=Bacillus subtilis (strain 168) GN=rocD PE=1 SV=2 48 445 3.0E-53
sp|C0ZBR4|OAT_BREBN Ornithine aminotransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rocD PE=3 SV=1 48 455 3.0E-53
sp|Q89RB7|OAT_BRADU Ornithine aminotransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rocD PE=3 SV=1 71 445 4.0E-53
sp|B5XTY7|PAT_KLEP3 Putrescine aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=patA PE=3 SV=1 80 439 4.0E-53
sp|A6TEB2|PAT_KLEP7 Putrescine aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=patA PE=3 SV=2 80 439 5.0E-53
sp|Q3YXH0|PAT_SHISS Putrescine aminotransferase OS=Shigella sonnei (strain Ss046) GN=patA PE=3 SV=2 75 455 7.0E-53
sp|Q9LCS5|ARGD_STRC2 Acetylornithine aminotransferase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argD PE=3 SV=1 61 447 1.0E-52
sp|A8APX8|PAT_CITK8 Putrescine aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=patA PE=3 SV=2 75 455 2.0E-52
sp|Q8Z3L9|PAT_SALTI Putrescine aminotransferase OS=Salmonella typhi GN=patA PE=3 SV=2 75 438 2.0E-52
sp|B4TIU6|PAT_SALHS Putrescine aminotransferase OS=Salmonella heidelberg (strain SL476) GN=patA PE=3 SV=1 75 438 2.0E-52
sp|Q7RT90|OAT_PLAYO Ornithine aminotransferase OS=Plasmodium yoelii yoelii GN=OAT PE=1 SV=1 60 447 3.0E-52
sp|Q92413|OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=otaA PE=3 SV=2 45 452 4.0E-52
sp|Q3ZCF5|OAT_BOVIN Ornithine aminotransferase, mitochondrial OS=Bos taurus GN=OAT PE=2 SV=1 49 451 5.0E-52
sp|Q8ZLX7|PAT_SALTY Putrescine aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=patA PE=3 SV=2 75 438 6.0E-52
sp|B4TVV2|PAT_SALSV Putrescine aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=patA PE=3 SV=1 75 438 6.0E-52
sp|B4T688|PAT_SALNS Putrescine aminotransferase OS=Salmonella newport (strain SL254) GN=patA PE=3 SV=1 75 438 6.0E-52
sp|B5F6B4|PAT_SALA4 Putrescine aminotransferase OS=Salmonella agona (strain SL483) GN=patA PE=3 SV=1 75 438 6.0E-52
sp|B5REH5|PAT_SALG2 Putrescine aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=patA PE=3 SV=2 75 438 7.0E-52
sp|B5QZ53|PAT_SALEP Putrescine aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=patA PE=3 SV=2 75 438 7.0E-52
sp|B5FHV3|PAT_SALDC Putrescine aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=patA PE=3 SV=1 75 438 7.0E-52
sp|C0PYZ1|PAT_SALPC Putrescine aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=patA PE=3 SV=2 75 438 1.0E-51
sp|Q57JP1|PAT_SALCH Putrescine aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=patA PE=3 SV=1 75 438 1.0E-51
sp|B5BG29|PAT_SALPK Putrescine aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=patA PE=3 SV=2 75 438 1.0E-51
sp|Q5PC95|PAT_SALPA Putrescine aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=patA PE=3 SV=2 75 438 1.0E-51
sp|A9MPU4|PAT_SALAR Putrescine aminotransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=patA PE=3 SV=2 75 438 2.0E-51
sp|A4WEQ6|PAT_ENT38 Putrescine aminotransferase OS=Enterobacter sp. (strain 638) GN=patA PE=3 SV=1 75 455 3.0E-51
sp|A9N5Z8|PAT_SALPB Putrescine aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=patA PE=3 SV=1 75 438 6.0E-51
sp|Q9I6M4|DAVT_PSEAE 5-aminovalerate aminotransferase DavT OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=davT PE=1 SV=1 69 451 1.0E-50
sp|Q9YBY6|ARGD_AERPE Acetylornithine/acetyl-lysine aminotransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=argD PE=3 SV=1 72 439 4.0E-50
sp|Q94AL9|AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana GN=AGT3 PE=1 SV=2 11 447 1.0E-49
sp|Q3UEG6|AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus GN=Agxt2 PE=1 SV=1 9 451 2.0E-49
sp|Q54JP5|OAT_DICDI Probable ornithine aminotransferase OS=Dictyostelium discoideum GN=oatA PE=3 SV=1 43 451 2.0E-49
sp|P07991|OAT_YEAST Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR2 PE=1 SV=2 60 451 1.0E-48
sp|Q6CWC1|OAT_KLULA Ornithine aminotransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR2 PE=1 SV=1 49 445 2.0E-48
sp|Q17QF0|AGT2_BOVIN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Bos taurus GN=AGXT2 PE=2 SV=1 9 451 6.0E-48
sp|P30268|Y2045_BACPE Uncharacterized aminotransferase BpOF4_10225 OS=Bacillus pseudofirmus (strain OF4) GN=BpOF4_10225 PE=3 SV=2 73 451 4.0E-47
sp|Q7M9K2|ECTB_WOLSU Diaminobutyrate--2-oxoglutarate transaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ectB PE=3 SV=1 54 450 4.0E-47
sp|Q9BYV1|AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens GN=AGXT2 PE=1 SV=1 56 451 6.0E-47
sp|P22256|GABT_ECOLI 4-aminobutyrate aminotransferase GabT OS=Escherichia coli (strain K12) GN=gabT PE=1 SV=1 70 451 6.0E-47
sp|Q5RFA3|AGT2_PONAB Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Pongo abelii GN=AGXT2 PE=2 SV=1 56 452 5.0E-46
sp|Q64565|AGT2_RAT Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Rattus norvegicus GN=Agxt2 PE=1 SV=2 9 451 7.0E-46
sp|Q9P7L5|OAT_SCHPO Ornithine aminotransferase car2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car2 PE=2 SV=1 60 451 2.0E-45
sp|Q6PR32|ECTB_VIRPA Diaminobutyrate--2-oxoglutarate transaminase OS=Virgibacillus pantothenticus GN=ectB PE=3 SV=1 62 447 6.0E-45
sp|Q88RB9|DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain KT2440) GN=davT PE=1 SV=1 70 452 9.0E-45
sp|Q9SR86|AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana GN=At3g08860 PE=2 SV=1 9 452 1.0E-44
sp|P40829|GABT_MYCLE 4-aminobutyrate aminotransferase OS=Mycobacterium leprae (strain TN) GN=gabT PE=3 SV=1 70 447 1.0E-44
sp|Q8ESU8|ECTB_OCEIH Diaminobutyrate--2-oxoglutarate transaminase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ectB PE=3 SV=1 45 450 5.0E-44
sp|P94427|GABT_BACSU Probable 4-aminobutyrate aminotransferase OS=Bacillus subtilis (strain 168) GN=gabT PE=3 SV=1 73 447 2.0E-43
sp|Q9ZJ10|ARGD_BACAM Acetylornithine aminotransferase (Fragment) OS=Bacillus amyloliquefaciens GN=argD PE=3 SV=1 61 297 6.0E-43
sp|Q9AP34|ECTB_SPOPA Diaminobutyrate--2-oxoglutarate transaminase OS=Sporosarcina pasteurii GN=ectB PE=2 SV=1 62 450 7.0E-43
sp|P16932|DGDA_BURCE 2,2-dialkylglycine decarboxylase OS=Burkholderia cepacia GN=dgdA PE=1 SV=3 69 451 3.0E-42
sp|Q7W979|ECTB_BORPA Diaminobutyrate--2-oxoglutarate transaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ectB PE=3 SV=1 69 447 4.0E-42
sp|Q7WHI8|ECTB_BORBR Diaminobutyrate--2-oxoglutarate transaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ectB PE=3 SV=1 69 447 4.0E-42
sp|O06060|ECTB_MARHA Diaminobutyrate--2-oxoglutarate transaminase OS=Marinococcus halophilus GN=ectB PE=3 SV=1 62 450 1.0E-41
sp|Q5YW77|ECTB_NOCFA Diaminobutyrate--2-oxoglutarate transaminase OS=Nocardia farcinica (strain IFM 10152) GN=ectB PE=3 SV=1 69 447 3.0E-41
sp|P33189|YHXA_BACSU Uncharacterized aminotransferase YhxA OS=Bacillus subtilis (strain 168) GN=yhxA PE=3 SV=4 74 451 7.0E-41
sp|Q940M2|AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=AGT2 PE=2 SV=1 40 439 1.0E-40
sp|Q9KED4|ECTB_BACHD Diaminobutyrate--2-oxoglutarate transaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ectB PE=3 SV=1 62 450 3.0E-40
sp|Q5WL78|ECTB_BACSK Diaminobutyrate--2-oxoglutarate transaminase OS=Bacillus clausii (strain KSM-K16) GN=ectB PE=3 SV=1 62 450 3.0E-40
sp|M1GRN3|ILE2E_LACBU Isoleucine 2-epimerase OS=Lactobacillus buchneri PE=1 SV=1 71 456 5.0E-40
sp|Q87NZ7|ECTB_VIBPA Diaminobutyrate--2-oxoglutarate transaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ectB PE=3 SV=1 69 450 9.0E-40
sp|Q829L4|ECTB_STRAW Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ectB PE=3 SV=1 62 450 2.0E-39
sp|Q9KLC2|ECTB_VIBCH Diaminobutyrate--2-oxoglutarate transaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ectB PE=3 SV=1 54 447 5.0E-39
sp|Q2FVJ6|BIOA_STAA8 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=bioA PE=3 SV=1 62 450 6.0E-39
sp|Q93RW1|ECTB_STRCO Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ectB PE=3 SV=1 62 450 2.0E-38
sp|O52250|ECTB_HALED Diaminobutyrate--2-oxoglutarate transaminase OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=ectB PE=1 SV=1 62 447 7.0E-37
sp|P9WQ79|GABT_MYCTU 4-aminobutyrate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabT PE=1 SV=1 70 447 9.0E-37
sp|P9WQ78|GABT_MYCTO 4-aminobutyrate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabT PE=3 SV=1 70 447 9.0E-37
sp|P63505|GABT_MYCBO 4-aminobutyrate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabT PE=3 SV=1 70 447 9.0E-37
sp|P56969|Y1815_ARCFU Uncharacterized aminotransferase AF_1815 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1815 PE=3 SV=1 59 453 7.0E-36
sp|P44951|DAT_HAEIN Diaminobutyrate--2-oxoglutarate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dat PE=1 SV=1 62 404 2.0E-34
sp|Q9VU95|AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster GN=CG8745 PE=2 SV=2 65 404 3.0E-34
sp|Q9ZEU7|ECTB_CHRSD Diaminobutyrate--2-oxoglutarate transaminase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ectB PE=3 SV=1 62 450 3.0E-34
sp|P91408|AGT2L_CAEEL Alanine--glyoxylate aminotransferase 2-like OS=Caenorhabditis elegans GN=T01B11.2 PE=3 SV=1 65 440 2.0E-33
sp|Q9Z3R2|RHBA_RHIME Diaminobutyrate--2-oxoglutarate aminotransferase OS=Rhizobium meliloti (strain 1021) GN=rhbA PE=3 SV=1 64 451 4.0E-33
sp|Q6QUY9|ECTB_STRAQ Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces anulatus GN=ectB PE=3 SV=1 62 447 6.0E-33
sp|Q58696|BIOA_METJA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=bioA PE=3 SV=2 71 450 2.0E-32
sp|Q84P54|GATP1_SOLLC Gamma aminobutyrate transaminase 1, mitochondrial OS=Solanum lycopersicum GN=GABA-TP1 PE=1 SV=1 69 455 2.0E-32
sp|P50457|PUUE_ECOLI 4-aminobutyrate aminotransferase PuuE OS=Escherichia coli (strain K12) GN=puuE PE=1 SV=1 76 452 2.0E-32
sp|Q9US34|YFZ7_SCHPO Uncharacterized aminotransferase C1039.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.07c PE=3 SV=1 69 454 1.0E-31
sp|Q01K11|GATP1_ORYSI Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17385 PE=3 SV=1 42 455 2.0E-31
sp|P31893|OAT_VIGAC Ornithine aminotransferase OS=Vigna aconitifolia PE=2 SV=1 74 396 2.0E-31
sp|Q9APM5|TPA_BILWA Taurine--pyruvate aminotransferase OS=Bilophila wadsworthia GN=tpa PE=1 SV=1 69 440 2.0E-31
sp|Q8BWU8|AT2L1_MOUSE Ethanolamine-phosphate phospho-lyase OS=Mus musculus GN=Etnppl PE=2 SV=1 46 439 3.0E-31
sp|Q94CE5|GATP_ARATH Gamma-aminobutyrate transaminase POP2, mitochondrial OS=Arabidopsis thaliana GN=POP2 PE=1 SV=1 69 455 8.0E-31
sp|Q7SY54|AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio GN=etnppl PE=2 SV=1 58 449 1.0E-30
sp|Q7XN11|GATP1_ORYSJ Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=OSL2 PE=1 SV=2 69 455 2.0E-30
sp|P55628|Y4QG_RHISN Uncharacterized aminotransferase y4qG OS=Rhizobium sp. (strain NGR234) GN=NGR_a01910 PE=3 SV=1 46 454 3.0E-30
sp|Q5E9S4|AT2L1_BOVIN Ethanolamine-phosphate phospho-lyase OS=Bos taurus GN=ETNPPL PE=2 SV=1 46 447 3.0E-30
sp|Q8R1K4|AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus GN=Phykpl PE=1 SV=1 65 433 4.0E-30
sp|P56744|DAT_ACIBA Diaminobutyrate--2-oxoglutarate aminotransferase OS=Acinetobacter baumannii GN=dat PE=1 SV=1 62 456 6.0E-30
sp|B8BBZ7|GATP3_ORYSI Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_28220 PE=3 SV=1 69 455 7.0E-30
sp|Q84P52|GATP3_SOLLC Gamma aminobutyrate transaminase 3, chloroplastic OS=Solanum lycopersicum GN=GABA-TP3 PE=1 SV=1 69 455 1.0E-29
sp|Q6ZCF0|GATP3_ORYSJ Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. japonica GN=Os08g0205900 PE=3 SV=1 69 455 1.0E-29
sp|O53379|Y3329_MYCTU Probable aminotransferase Rv3329 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3329 PE=1 SV=2 70 406 1.0E-29
sp|Q8IUZ5|AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens GN=PHYKPL PE=1 SV=1 65 419 1.0E-29
sp|Q8TBG4|AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens GN=ETNPPL PE=1 SV=1 58 453 1.0E-29
sp|Q7XN12|GATP2_ORYSJ Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os04g0614500 PE=2 SV=2 69 455 2.0E-29
sp|Q01K12|GATP2_ORYSI Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17384 PE=3 SV=1 69 455 2.0E-29
sp|P22805|BIOA_LYSSH Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Lysinibacillus sphaericus GN=bioA PE=1 SV=1 66 445 3.0E-29
sp|Q74CT9|BIOA_GEOSL Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioA PE=3 SV=1 69 440 4.0E-29
sp|O66557|BIOA_AQUAE Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=bioA PE=3 SV=1 71 450 5.0E-29
sp|Q6ZH29|GATP4_ORYSJ Probable gamma-aminobutyrate transaminase 4 OS=Oryza sativa subsp. japonica GN=GABA-T PE=2 SV=1 44 455 8.0E-29
sp|Q6DEB1|AT2L1_XENLA Ethanolamine-phosphate phospho-lyase OS=Xenopus laevis GN=etnppl PE=2 SV=1 58 439 8.0E-28
sp|O66998|GSA_AQUAE Glutamate-1-semialdehyde 2,1-aminomutase OS=Aquifex aeolicus (strain VF5) GN=hemL PE=3 SV=1 70 382 3.0E-27
sp|O34662|YODT_BACSU Uncharacterized aminotransferase YodT OS=Bacillus subtilis (strain 168) GN=yodT PE=3 SV=1 70 452 1.0E-26
sp|P9WQ77|LAT_MYCTU Probable L-lysine-epsilon aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lat PE=1 SV=1 72 454 2.0E-25
sp|P9WQ76|LAT_MYCTO Probable L-lysine-epsilon aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lat PE=3 SV=1 72 454 2.0E-25
sp|P63510|LAT_MYCBO Probable L-lysine-epsilon aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lat PE=3 SV=1 72 454 2.0E-25
sp|P80404|GABT_HUMAN 4-aminobutyrate aminotransferase, mitochondrial OS=Homo sapiens GN=ABAT PE=1 SV=3 42 452 2.0E-25
sp|B7GHM5|BIOA_ANOFW Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioA PE=3 SV=1 65 454 3.0E-25
sp|B9LA83|GSA_NAUPA Glutamate-1-semialdehyde 2,1-aminomutase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=hemL PE=3 SV=1 69 382 3.0E-25
sp|P80147|GABT_PIG 4-aminobutyrate aminotransferase, mitochondrial OS=Sus scrofa GN=ABAT PE=1 SV=2 72 452 4.0E-25
sp|Q84P53|GATP2_SOLLC Gamma aminobutyrate transaminase 2 OS=Solanum lycopersicum GN=GABA-TP2 PE=1 SV=1 69 455 4.0E-25
sp|Q7M181|ACLR_ACHOB 2-aminohexano-6-lactam racemase OS=Achromobacter obae PE=1 SV=1 69 452 4.0E-25
sp|Q1CUJ7|GSA_HELPH Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter pylori (strain HPAG1) GN=hemL PE=3 SV=1 69 404 5.0E-25
sp|P50554|GABT_RAT 4-aminobutyrate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Abat PE=1 SV=3 42 447 8.0E-25
sp|P36568|BIOA_SERMA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Serratia marcescens GN=bioA PE=3 SV=1 127 440 1.0E-24
sp|A6Q2X6|GSA_NITSB Glutamate-1-semialdehyde 2,1-aminomutase OS=Nitratiruptor sp. (strain SB155-2) GN=hemL PE=3 SV=1 69 417 2.0E-24
sp|D5AKY0|TPA_RHOCB Taurine--pyruvate aminotransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=tpa PE=2 SV=1 54 440 2.0E-24
sp|B6JKN5|GSA_HELP2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter pylori (strain P12) GN=hemL PE=3 SV=1 69 404 4.0E-24
sp|A8ETJ2|GSA_ARCB4 Glutamate-1-semialdehyde 2,1-aminomutase OS=Arcobacter butzleri (strain RM4018) GN=hemL PE=3 SV=1 69 403 5.0E-24
sp|Q53196|Y4UB_RHISN Uncharacterized aminotransferase y4uB OS=Rhizobium sp. (strain NGR234) GN=NGR_a01380 PE=3 SV=1 67 440 5.0E-24
sp|P61922|GABT_MOUSE 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus GN=Abat PE=1 SV=1 42 447 5.0E-24
sp|A6TJD8|GSA_ALKMQ Glutamate-1-semialdehyde 2,1-aminomutase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hemL PE=3 SV=1 69 379 6.0E-24
sp|C1DUY4|GSA_SULAA Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825) GN=hemL PE=3 SV=1 70 396 7.0E-24
sp|B5ZA72|GSA_HELPG Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter pylori (strain G27) GN=hemL PE=3 SV=1 69 404 1.0E-23
sp|Q9BGI0|GABT_BOVIN 4-aminobutyrate aminotransferase, mitochondrial OS=Bos taurus GN=ABAT PE=2 SV=1 72 452 6.0E-23
sp|Q55FI1|GABT_DICDI 4-aminobutyrate aminotransferase OS=Dictyostelium discoideum GN=gabT PE=3 SV=1 16 441 6.0E-23
sp|Q9ZMD0|GSA_HELPJ Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hemL PE=3 SV=1 69 404 6.0E-23
sp|B2USD7|GSA_HELPS Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter pylori (strain Shi470) GN=hemL PE=3 SV=1 69 404 7.0E-23
sp|Q17X40|GSA_HELAH Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter acinonychis (strain Sheeba) GN=hemL PE=3 SV=1 69 404 9.0E-23
sp|A0RQ51|GSA_CAMFF Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hemL PE=3 SV=1 70 405 1.0E-22
sp|P56115|GSA_HELPY Glutamate-1-semialdehyde 2,1-aminomutase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hemL PE=3 SV=1 69 404 3.0E-22
sp|O94562|YGD3_SCHPO Uncharacterized aminotransferase C1771.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.03c PE=3 SV=1 69 406 5.0E-22
sp|P49604|GABAT_USTMA 4-aminobutyrate aminotransferase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GATA PE=2 SV=2 72 451 1.0E-21
sp|Q01767|LAT_STRC2 L-lysine-epsilon aminotransferase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=lat PE=1 SV=1 77 450 1.0E-21
sp|A4J6H0|GSA_DESRM Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfotomaculum reducens (strain MI-1) GN=hemL PE=3 SV=1 69 378 1.0E-21
sp|A6UWB3|GSA_META3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hemL PE=3 SV=1 50 371 2.0E-21
sp|Q97B25|GSA_THEVO Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hemL PE=3 SV=1 65 382 2.0E-21
sp|A4IRG2|GSA2_GEOTN Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemL2 PE=3 SV=1 70 422 2.0E-21
sp|P50277|BIOA_YEAST Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO3 PE=3 SV=1 137 449 3.0E-21
sp|A4SGT2|GSA_CHLPM Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hemL PE=3 SV=1 70 383 4.0E-21
sp|A9A1A0|GSA_NITMS Glutamate-1-semialdehyde 2,1-aminomutase OS=Nitrosopumilus maritimus (strain SCM1) GN=hemL PE=3 SV=1 65 379 6.0E-21
sp|O13837|GABAT_SCHPO 4-aminobutyrate aminotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uga1 PE=1 SV=1 42 449 7.0E-21
sp|Q05174|LAT_AMYLA L-lysine-epsilon aminotransferase OS=Amycolatopsis lactamdurans GN=lat PE=3 SV=1 77 456 9.0E-21
sp|Q10174|YAV5_SCHPO Uncharacterized aminotransferase C27F1.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27F1.05c PE=3 SV=1 159 452 1.0E-20
sp|B2A1H4|GSA_NATTJ Glutamate-1-semialdehyde 2,1-aminomutase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hemL PE=3 SV=1 70 405 1.0E-20
sp|A5N5Y1|GSA_CLOK5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hemL PE=3 SV=1 69 319 2.0E-20
sp|B9DZG0|GSA_CLOK1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium kluyveri (strain NBRC 12016) GN=hemL PE=3 SV=2 69 319 2.0E-20
sp|B3EKJ7|GSA_CHLPB Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium phaeobacteroides (strain BS1) GN=hemL PE=3 SV=1 70 379 2.0E-20
sp|Q7M847|GSA_WOLSU Glutamate-1-semialdehyde 2,1-aminomutase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hemL PE=3 SV=1 69 345 3.0E-20
sp|Q2RJ31|GSA_MOOTA Glutamate-1-semialdehyde 2,1-aminomutase OS=Moorella thermoacetica (strain ATCC 39073) GN=hemL PE=3 SV=1 69 378 3.0E-20
sp|Q5KWK9|GSA2_GEOKA Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=hemL2 PE=3 SV=1 70 422 5.0E-20
sp|Q6CJ86|GABAT_KLULA 4-aminobutyrate aminotransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F20548g PE=3 SV=1 37 447 6.0E-20
sp|B4S3Q6|GSA_PROA2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hemL PE=3 SV=1 69 379 7.0E-20
sp|Q9I700|BAUA_PSEAE Beta-alanine--pyruvate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauA PE=1 SV=1 64 451 8.0E-20
sp|E1WTS4|BIOAB_BACF6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain 638R) GN=bioB PE=3 SV=1 107 440 9.0E-20
sp|A5CXH8|GSA_VESOH Glutamate-1-semialdehyde 2,1-aminomutase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hemL PE=3 SV=1 69 376 9.0E-20
sp|A1AVQ1|GSA_RUTMC Glutamate-1-semialdehyde 2,1-aminomutase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hemL PE=3 SV=1 69 376 1.0E-19
sp|A4YD91|GSA_METS5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hemL PE=3 SV=1 67 395 2.0E-19
sp|B1I4L1|GSA_DESAP Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulforudis audaxviator (strain MP104C) GN=hemL PE=3 SV=1 45 451 2.0E-19
sp|A0Q2A8|GSA_CLONN Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium novyi (strain NT) GN=hemL PE=3 SV=1 70 379 2.0E-19
sp|C0QQ98|GSA_PERMH Glutamate-1-semialdehyde 2,1-aminomutase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hemL PE=3 SV=1 70 383 2.0E-19
sp|E1V7V7|DOED_HALED Diaminobutyrate--2-oxoglutarate transaminase OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=doeD PE=3 SV=1 68 440 2.0E-19
sp|Q1IHV2|GSA_KORVE Glutamate-1-semialdehyde 2,1-aminomutase OS=Koribacter versatilis (strain Ellin345) GN=hemL PE=3 SV=1 69 381 2.0E-19
sp|Q3ACS9|GSA_CARHZ Glutamate-1-semialdehyde 2,1-aminomutase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hemL PE=3 SV=1 70 386 3.0E-19
sp|P17649|GABAT_YEAST 4-aminobutyrate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA1 PE=1 SV=2 35 450 3.0E-19
sp|A7GXK4|GSA_CAMC5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter curvus (strain 525.92) GN=hemL PE=3 SV=1 69 378 3.0E-19
sp|B8FBA1|GSA_DESAA Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=hemL PE=3 SV=1 70 378 3.0E-19
sp|A6VUX8|GSA_MARMS Glutamate-1-semialdehyde 2,1-aminomutase OS=Marinomonas sp. (strain MWYL1) GN=hemL PE=3 SV=1 69 378 3.0E-19
sp|Q64VX4|BIOAB_BACFR Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain YCH46) GN=bioB PE=3 SV=1 107 440 3.0E-19
sp|Q5LEY1|BIOAB_BACFN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=bioB PE=3 SV=1 107 440 4.0E-19
sp|B2V5U0|GSA_SULSY Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=hemL PE=3 SV=1 46 382 4.0E-19
sp|A7HIX3|GSA_ANADF Glutamate-1-semialdehyde 2,1-aminomutase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=hemL PE=3 SV=1 69 382 4.0E-19
sp|A5EXX1|GSA_DICNV Glutamate-1-semialdehyde 2,1-aminomutase OS=Dichelobacter nodosus (strain VCS1703A) GN=hemL PE=3 SV=1 70 382 5.0E-19
sp|Q1QSB0|GSA_CHRSD Glutamate-1-semialdehyde 2,1-aminomutase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hemL PE=3 SV=1 70 345 5.0E-19
sp|Q92BG1|GSA1_LISIN Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hemL1 PE=3 SV=1 70 382 6.0E-19
sp|P45488|BIOA_MYCLE Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium leprae (strain TN) GN=bioA PE=3 SV=1 63 349 6.0E-19
sp|Q9ZKM5|BIOA_HELPJ Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bioA PE=3 SV=1 74 450 6.0E-19
sp|Q0I8G1|GSA_SYNS3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain CC9311) GN=hemL PE=3 SV=1 69 429 6.0E-19
sp|Q6L2G9|GSA_PICTO Glutamate-1-semialdehyde 2,1-aminomutase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hemL PE=3 SV=1 65 382 6.0E-19
sp|Q9HKM6|GSA_THEAC Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hemL PE=3 SV=2 65 379 8.0E-19
sp|Q3B1A1|GSA_CHLL7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hemL PE=3 SV=1 70 345 8.0E-19
sp|Q4L706|GSA2_STAHJ Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hemL2 PE=3 SV=1 69 421 9.0E-19
sp|P53656|BIOA_ESCVU Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Escherichia vulneris GN=bioA PE=3 SV=1 132 440 1.0E-18
sp|P12677|BIOA_SALTY Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioA PE=3 SV=2 59 376 1.0E-18
sp|A4XK09|GSA_CALS8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hemL PE=3 SV=1 69 358 1.0E-18
sp|B9MRJ7|GSA_CALBD Glutamate-1-semialdehyde 2,1-aminomutase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=hemL PE=3 SV=1 69 358 2.0E-18
sp|A0RXB3|GSA1_CENSY Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Cenarchaeum symbiosum (strain A) GN=hemL1 PE=3 SV=2 65 363 2.0E-18
sp|C3MYE0|GSA_SULIM Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hemL PE=3 SV=1 67 345 2.0E-18
sp|C3MZR9|GSA_SULIA Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain M.16.27) GN=hemL PE=3 SV=1 67 345 2.0E-18
sp|Q9Y9I9|GSA_AERPE Glutamate-1-semialdehyde 2,1-aminomutase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hemL PE=1 SV=2 67 320 2.0E-18
sp|P44426|BIOA_HAEIN Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioA PE=3 SV=1 154 440 2.0E-18
sp|P14010|GABAT_EMENI 4-aminobutyrate aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gatA PE=3 SV=1 72 394 2.0E-18
sp|P28269|OAPT_PSEPU Omega-amino acid--pyruvate aminotransferase OS=Pseudomonas putida PE=1 SV=1 38 451 3.0E-18
sp|B9L0Q2|GSA_THERP Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=hemL PE=3 SV=1 69 345 3.0E-18
sp|C3N842|GSA_SULIY Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hemL PE=3 SV=1 67 345 3.0E-18
sp|C3NF69|GSA_SULIN Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hemL PE=3 SV=1 67 345 3.0E-18
sp|C3MJ22|GSA_SULIL Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hemL PE=3 SV=1 67 345 3.0E-18
sp|C4KJ00|GSA_SULIK Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hemL PE=3 SV=1 67 345 3.0E-18
sp|E6SRG2|BIOAB_BACT6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / P 36-108) GN=bioB PE=3 SV=1 150 440 3.0E-18
sp|Q6M0P5|GSA_METMP Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain S2 / LL) GN=hemL PE=3 SV=1 50 383 3.0E-18
sp|Q2S8X9|GSA_HAHCH Glutamate-1-semialdehyde 2,1-aminomutase OS=Hahella chejuensis (strain KCTC 2396) GN=hemL PE=3 SV=1 69 378 4.0E-18
sp|Q6FCY1|GSA_ACIAD Glutamate-1-semialdehyde 2,1-aminomutase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hemL PE=3 SV=1 70 376 4.0E-18
sp|A6URL2|GSA_METVS Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hemL PE=3 SV=1 67 383 5.0E-18
sp|C4L4J9|GSA2_EXISA Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hemL2 PE=3 SV=1 70 383 5.0E-18
sp|Q9K8G3|GSA2_BACHD Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemL2 PE=3 SV=1 70 389 6.0E-18
sp|B2HW19|GSA_ACIBC Glutamate-1-semialdehyde 2,1-aminomutase OS=Acinetobacter baumannii (strain ACICU) GN=hemL PE=3 SV=1 70 376 6.0E-18
sp|B0VCN6|GSA_ACIBY Glutamate-1-semialdehyde 2,1-aminomutase OS=Acinetobacter baumannii (strain AYE) GN=hemL PE=3 SV=1 70 376 7.0E-18
sp|A3M7I8|GSA_ACIBT Glutamate-1-semialdehyde 2,1-aminomutase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hemL PE=3 SV=2 70 376 7.0E-18
sp|B7I4N4|GSA_ACIB5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Acinetobacter baumannii (strain AB0057) GN=hemL PE=3 SV=1 70 376 7.0E-18
sp|B7GYZ5|GSA_ACIB3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Acinetobacter baumannii (strain AB307-0294) GN=hemL PE=3 SV=1 70 376 7.0E-18
sp|Q9PP70|GSA_CAMJE Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hemL PE=3 SV=1 69 345 9.0E-18
sp|A8FLR2|GSA_CAMJ8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hemL PE=3 SV=1 69 345 1.0E-17
sp|A6Q9P9|GSA_SULNB Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfurovum sp. (strain NBC37-1) GN=hemL PE=3 SV=1 69 319 1.0E-17
sp|A1VZJ6|GSA_CAMJJ Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hemL PE=3 SV=1 69 345 1.0E-17
sp|Q3AP59|GSA_CHLCH Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium chlorochromatii (strain CaD3) GN=hemL PE=3 SV=1 69 379 1.0E-17
sp|Q5HUU3|GSA_CAMJR Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni (strain RM1221) GN=hemL PE=3 SV=1 69 345 1.0E-17
sp|B2G9H2|GSA_LACRJ Glutamate-1-semialdehyde 2,1-aminomutase OS=Lactobacillus reuteri (strain JCM 1112) GN=hemL PE=3 SV=1 70 378 1.0E-17
sp|A5VM65|GSA_LACRD Glutamate-1-semialdehyde 2,1-aminomutase OS=Lactobacillus reuteri (strain DSM 20016) GN=hemL PE=3 SV=1 70 378 1.0E-17
sp|A7H3N1|GSA_CAMJD Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hemL PE=3 SV=1 69 345 1.0E-17
sp|B2UX41|GSA_CLOBA Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hemL PE=3 SV=1 69 392 1.0E-17
sp|Q21MJ0|GSA_SACD2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hemL PE=3 SV=1 70 382 1.0E-17
sp|B4SGW1|GSA_PELPB Glutamate-1-semialdehyde 2,1-aminomutase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hemL PE=3 SV=1 70 381 1.0E-17
sp|B2TPD4|GSA_CLOBB Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=hemL PE=3 SV=1 69 382 1.0E-17
sp|A6LKX4|GSA_THEM4 Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=hemL PE=3 SV=1 70 319 1.0E-17
sp|Q5WWG1|GSA_LEGPL Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila (strain Lens) GN=hemL PE=3 SV=1 70 320 1.0E-17
sp|Q7WF71|GSA_BORBR Glutamate-1-semialdehyde 2,1-aminomutase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemL PE=3 SV=1 70 378 1.0E-17
sp|Q7W3U1|GSA_BORPA Glutamate-1-semialdehyde 2,1-aminomutase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemL PE=3 SV=1 70 378 1.0E-17
sp|B2SGG7|GSA_FRATM Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=hemL PE=3 SV=1 70 378 2.0E-17
sp|B3EI07|GSA_CHLL2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hemL PE=3 SV=1 69 379 2.0E-17
sp|Q71ZB5|GSA1_LISMF Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hemL1 PE=3 SV=1 70 357 2.0E-17
sp|C1KVK0|GSA1_LISMC Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hemL1 PE=3 SV=1 70 357 2.0E-17
sp|A5D3M2|GSA_PELTS Glutamate-1-semialdehyde 2,1-aminomutase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hemL PE=3 SV=1 70 345 2.0E-17
sp|A5IC29|GSA_LEGPC Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila (strain Corby) GN=hemL PE=3 SV=1 70 320 2.0E-17
sp|P53555|BIOK_BACSU L-Lysine--8-amino-7-oxononanoate transaminase OS=Bacillus subtilis (strain 168) GN=bioK PE=1 SV=1 65 450 2.0E-17
sp|A5GMT2|GSA_SYNPW Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain WH7803) GN=hemL PE=3 SV=1 69 378 2.0E-17
sp|A4IXN8|GSA_FRATW Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=hemL PE=3 SV=1 70 378 2.0E-17
sp|Q8RFY7|GSA_FUSNN Glutamate-1-semialdehyde 2,1-aminomutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hemL PE=3 SV=1 67 383 2.0E-17
sp|A5GUJ2|GSA_SYNR3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain RCC307) GN=hemL PE=3 SV=1 69 378 2.0E-17
sp|A6VIL1|GSA_METM7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hemL PE=3 SV=1 67 383 2.0E-17
sp|Q8A7T2|BIOAB_BACTN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=bioB PE=3 SV=2 56 386 2.0E-17
sp|A7ZCH5|GSA_CAMC1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Campylobacter concisus (strain 13826) GN=hemL PE=3 SV=1 69 398 3.0E-17
sp|A8FFU9|GSA2_BACP2 Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus pumilus (strain SAFR-032) GN=hemL2 PE=3 SV=1 70 381 3.0E-17
sp|O25627|BIOA_HELPY Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bioA PE=3 SV=1 74 326 3.0E-17
sp|Q5ZVA6|GSA_LEGPH Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hemL PE=3 SV=2 70 320 3.0E-17
sp|Q8KAQ7|GSA_CHLTE Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hemL PE=3 SV=1 69 383 3.0E-17
sp|A2BL27|GSA_HYPBU Glutamate-1-semialdehyde 2,1-aminomutase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=hemL PE=3 SV=1 67 344 3.0E-17
sp|Q8Y6X8|GSA1_LISMO Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hemL1 PE=3 SV=1 70 357 3.0E-17
sp|Q6AB08|GSA_PROAC Glutamate-1-semialdehyde 2,1-aminomutase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hemL PE=3 SV=1 70 378 3.0E-17
sp|Q6GG38|GSA1_STAAR Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Staphylococcus aureus (strain MRSA252) GN=hemL1 PE=3 SV=1 69 417 3.0E-17
sp|A7Z7A2|GSA2_BACMF Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hemL2 PE=3 SV=1 70 378 4.0E-17
sp|Q980U5|GSA_SULSO Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hemL PE=1 SV=2 67 346 4.0E-17
sp|Q3SFU6|GSA_THIDA Glutamate-1-semialdehyde 2,1-aminomutase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hemL PE=3 SV=1 69 376 4.0E-17
sp|B8I0R1|GSA_CLOCE Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hemL PE=3 SV=1 70 413 4.0E-17
sp|Q0TQG7|GSA_CLOP1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=hemL PE=3 SV=1 69 358 4.0E-17
sp|B3E9X0|GSA_GEOLS Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hemL PE=3 SV=1 70 376 4.0E-17
sp|A0Q628|GSA_FRATN Glutamate-1-semialdehyde 2,1-aminomutase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemL PE=3 SV=1 70 378 4.0E-17
sp|Q5X529|GSA_LEGPA Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila (strain Paris) GN=hemL PE=3 SV=1 70 320 4.0E-17
sp|Q3AWP4|GSA_SYNS9 Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain CC9902) GN=hemL PE=3 SV=2 69 376 5.0E-17
sp|B1HVD3|GSA2_LYSSC Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=hemL2 PE=3 SV=1 70 383 5.0E-17
sp|P0C2D9|GSA_CLOPE Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium perfringens (strain 13 / Type A) GN=hemL PE=3 SV=1 69 358 5.0E-17
sp|A1BJG8|GSA_CHLPD Glutamate-1-semialdehyde 2,1-aminomutase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hemL PE=3 SV=1 69 383 5.0E-17
sp|P9WQ81|BIOA_MYCTU Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioA PE=1 SV=1 76 380 5.0E-17
sp|P9WQ80|BIOA_MYCTO Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioA PE=3 SV=1 76 380 5.0E-17
sp|P0A4X7|BIOA_MYCBO Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=bioA PE=3 SV=1 76 380 5.0E-17
sp|A1TYG5|GSA_MARHV Glutamate-1-semialdehyde 2,1-aminomutase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hemL PE=3 SV=1 69 376 6.0E-17
sp|Q7W050|GSA_BORPE Glutamate-1-semialdehyde 2,1-aminomutase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemL PE=3 SV=1 70 378 6.0E-17
sp|Q976H2|GSA_SULTO Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hemL PE=3 SV=3 66 391 6.0E-17
sp|Q31FB1|GSA_THICR Glutamate-1-semialdehyde 2,1-aminomutase OS=Thiomicrospira crunogena (strain XCL-2) GN=hemL PE=3 SV=1 69 378 7.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0008483 transaminase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0097159 organic cyclic compound binding No
GO:0019842 vitamin binding No
GO:0070279 vitamin B6 binding No
GO:0016769 transferase activity, transferring nitrogenous groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4228
MALAVGRTVPRRCLASTASAPATGLADDVRQAIERDASLPNPDPRSDSASAALVAEHGPYMVATYARPPPVFVRG
QGSWLWDVENRKYLDFTAGIAVTSLGHCDAELGNIVADQANTLVHASNLYYNPWTGALSKLLVEKTAESGGMHDV
KAAFICNSGSEANEAAIKFARKVGKARDPSGEKHEIVSFDHAFHGRTMGSLSATHNVKYQKPFSPMVPGFRQGRL
NDVAAIDEVVTERTCGVMVEPIQGEGGVRPASDEFLTALAKRARQVGAVLIYDEIQCGLSRTGSFWAHVGLPQAA
HPDILTTAKALGNGFPIGAVLVNSSVNEAIKMGDHGTTFGGNPLACRVAHNVVGRLSDARLQRSVQAKSELFRRG
LDQLRERFPRVVGETRGRGLILGLQLREDPAGIVRAARERGLLIITAGTDTLRFVPALTVEEEEIGVGMEVLGEA
FAVTRG*
Coding >Ophun1|4228
ATGGCCTTGGCTGTCGGTCGGACGGTTCCGAGGCGGTGCTTGGCCTCGACAGCGTCGGCTCCGGCCACGGGCTTG
GCTGACGACGTGCGGCAGGCGATAGAGAGGGATGCCTCGCTGCCGAATCCCGATCCGAGATCCGATTCGGCCAGT
GCGGCGCTCGTGGCCGAACACGGGCCGTATATGGTGGCAACTTATGCCCGGCCGCCGCCCGTCTTCGTCCGCGGT
CAAGGCTCGTGGCTGTGGGACGTGGAGAACAGGAAATATCTCGACTTTACAGCCGGGATCGCCGTCACGTCGCTG
GGACACTGTGATGCTGAGCTGGGAAACATTGTGGCCGATCAGGCCAATACGCTGGTGCACGCGTCAAACCTGTAC
TATAACCCCTGGACGGGCGCCCTGTCAAAGTTGCTGGTCGAGAAGACGGCGGAGTCGGGCGGGATGCACGACGTC
AAGGCCGCCTTTATCTGCAACTCGGGCTCCGAGGCTAACGAGGCGGCCATCAAGTTTGCTCGCAAAGTGGGCAAG
GCGAGGGATCCGTCGGGCGAAAAGCATGAAATCGTCTCCTTCGATCATGCCTTTCACGGCCGAACCATGGGCAGC
TTATCGGCGACGCACAACGTCAAGTATCAGAAGCCCTTTTCGCCCATGGTTCCGGGCTTCCGGCAGGGTCGGCTG
AATGACGTGGCGGCCATTGATGAGGTCGTGACGGAGCGGACGTGTGGTGTCATGGTCGAGCCTATTCAGGGAGAG
GGTGGCGTGCGGCCGGCGAGTGATGAGTTTCTGACGGCCTTGGCTAAGAGGGCCAGACAGGTCGGTGCTGTTCTT
ATCTATGACGAGATTCAGTGCGGTCTCTCGAGGACGGGATCTTTCTGGGCGCACGTCGGCCTCCCGCAGGCGGCT
CATCCGGACATCCTGACGACGGCCAAGGCGTTGGGCAACGGATTCCCCATCGGTGCCGTCCTGGTCAACAGCAGC
GTCAACGAAGCCATCAAGATGGGCGATCACGGAACCACCTTTGGCGGCAACCCGCTCGCATGTCGTGTAGCTCAC
AACGTCGTCGGCCGTCTCTCCGACGCAAGACTCCAGCGCTCAGTGCAAGCCAAGAGCGAGCTTTTCCGCCGTGGC
CTCGATCAACTTCGCGAGCGCTTCCCCCGCGTCGTGGGCGAGACGCGCGGCAGGGGTCTCATCTTGGGCTTGCAG
CTTCGAGAGGACCCGGCTGGCATCGTCAGGGCGGCGAGGGAGAGGGGCCTGCTTATCATTACCGCGGGGACCGAC
ACGCTGAGGTTCGTGCCGGCTTTGACGGTCGAGGAGGAGGAGATTGGGGTGGGGATGGAGGTGCTGGGGGAGGCT
TTTGCGGTGACGCGGGGATGA
Transcript >Ophun1|4228
ATGGCCTTGGCTGTCGGTCGGACGGTTCCGAGGCGGTGCTTGGCCTCGACAGCGTCGGCTCCGGCCACGGGCTTG
GCTGACGACGTGCGGCAGGCGATAGAGAGGGATGCCTCGCTGCCGAATCCCGATCCGAGATCCGATTCGGCCAGT
GCGGCGCTCGTGGCCGAACACGGGCCGTATATGGTGGCAACTTATGCCCGGCCGCCGCCCGTCTTCGTCCGCGGT
CAAGGCTCGTGGCTGTGGGACGTGGAGAACAGGAAATATCTCGACTTTACAGCCGGGATCGCCGTCACGTCGCTG
GGACACTGTGATGCTGAGCTGGGAAACATTGTGGCCGATCAGGCCAATACGCTGGTGCACGCGTCAAACCTGTAC
TATAACCCCTGGACGGGCGCCCTGTCAAAGTTGCTGGTCGAGAAGACGGCGGAGTCGGGCGGGATGCACGACGTC
AAGGCCGCCTTTATCTGCAACTCGGGCTCCGAGGCTAACGAGGCGGCCATCAAGTTTGCTCGCAAAGTGGGCAAG
GCGAGGGATCCGTCGGGCGAAAAGCATGAAATCGTCTCCTTCGATCATGCCTTTCACGGCCGAACCATGGGCAGC
TTATCGGCGACGCACAACGTCAAGTATCAGAAGCCCTTTTCGCCCATGGTTCCGGGCTTCCGGCAGGGTCGGCTG
AATGACGTGGCGGCCATTGATGAGGTCGTGACGGAGCGGACGTGTGGTGTCATGGTCGAGCCTATTCAGGGAGAG
GGTGGCGTGCGGCCGGCGAGTGATGAGTTTCTGACGGCCTTGGCTAAGAGGGCCAGACAGGTCGGTGCTGTTCTT
ATCTATGACGAGATTCAGTGCGGTCTCTCGAGGACGGGATCTTTCTGGGCGCACGTCGGCCTCCCGCAGGCGGCT
CATCCGGACATCCTGACGACGGCCAAGGCGTTGGGCAACGGATTCCCCATCGGTGCCGTCCTGGTCAACAGCAGC
GTCAACGAAGCCATCAAGATGGGCGATCACGGAACCACCTTTGGCGGCAACCCGCTCGCATGTCGTGTAGCTCAC
AACGTCGTCGGCCGTCTCTCCGACGCAAGACTCCAGCGCTCAGTGCAAGCCAAGAGCGAGCTTTTCCGCCGTGGC
CTCGATCAACTTCGCGAGCGCTTCCCCCGCGTCGTGGGCGAGACGCGCGGCAGGGGTCTCATCTTGGGCTTGCAG
CTTCGAGAGGACCCGGCTGGCATCGTCAGGGCGGCGAGGGAGAGGGGCCTGCTTATCATTACCGCGGGGACCGAC
ACGCTGAGGTTCGTGCCGGCTTTGACGGTCGAGGAGGAGGAGATTGGGGTGGGGATGGAGGTGCTGGGGGAGGCT
TTTGCGGTGACGCGGGGATGA
Gene >Ophun1|4228
ATGGCCTTGGCTGTCGGTCGGACGGTTCCGAGGCGGTGCTTGGCCTCGACAGCGTCGGCTCCGGCCACGGGCTTG
GCTGACGACGTGCGGCAGGCGATAGAGGTGAGAGGAGGAGCACATCCGGACGGGAATCGTCGCTGACTGAATGGA
AGAGGGATGCCTCGCTGCCGAATCCCGATCCGAGATCCGATTCGGCCAGTGCGGCGCTCGTGGCCGAACACGGGC
CGTATATGGTGGCAACTTATGCCCGGCCGCCGCCCGTCTTCGTCCGCGGTCAAGGCTCGTGGCTGTGGGACGTGG
AGAACAGGAAATATCTCGACTTTACAGCCGGGATCGCCGTCACGTCGCTGGGACACTGTGATGCTGAGCTGGGAA
ACATTGTGGCCGATCAGGTACGCCGGCTTCGTCAGGTCATCGGGAGAGGCTGACCGGGCGAGAGAATGGCAGGCC
AATACGCTGGTGCACGCGTCAAACCTGTACTATAACCCCTGGACGGGCGCCCTGTCAAAGTTGCTGGTCGAGAAG
ACGGCGGAGTCGGGCGGGATGCACGACGTCAAGGCCGCCTTTATCTGCAACTCGGGCTCCGAGGCTAACGAGGCG
GCCATCAAGTTTGCTCGCAAAGTGGGCAAGGCGAGGGATCCGTCGGGCGAAAAGCATGAAATCGTCTCCTTCGAT
CATGCCTTTCACGGCCGAACCATGGGCAGCTTATCGGCGACGCACAACGTCAAGTATCAGAAGCCCTTTTCGCCC
ATGGTTCCGGGCTTCCGGCAGGGTCGGCTGAATGACGTGGCGGCCATTGATGAGGTCGTGACGGAGCGGACGTGT
GGTGTCATGGTCGAGCCTATTCAGGGAGAGGGTGGCGTGCGGCCGGCGAGTGATGAGTTTCTGACGGCCTTGGCT
AAGAGGGCCAGACAGGTCGGTGCTGTTCTTATCTATGACGAGATTCAGTGCGGTCTCTCGAGGACGGGATCTTTC
TGGGCGCACGTCGGCCTCCCGCAGGCGGCTCATCCGGACATCCTGACGACGGCCAAGGCGTTGGGCAACGGATTC
CCCATCGGTGCCGTCCTGGTCAACAGCAGCGTCAACGAAGCCATCAAGATGGGCGATCACGGAACCACCTTTGGC
GGCAACCCGCTCGCATGTCGTGTAGCTCACAACGTCGTCGGCCGTCTCTCCGACGCAAGACTCCAGCGCTCAGTG
CAAGCCAAGAGCGAGCTTTTCCGCCGTGGCCTCGATCAACTTCGCGAGCGCTTCCCCCGCGTCGTGGGCGAGACG
CGCGGCAGGGGTCTCATCTTGGGCTTGCAGCTTCGAGAGGACCCGGCTGGCATCGTCAGGGCGGCGAGGGAGAGG
GGCCTGCTTATCATTACCGCGGGGACCGACACGCTGAGGTTCGTGCCGGCTTTGACGGTCGAGGAGGAGGAGATT
GGGGTGGGGATGGAGGTGCTGGGGGAGGCTTTTGCGGTGACGCGGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail