Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4219
Gene name
LocationContig_389:10430..11966
Strand+
Gene length (bp)1536
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-48 51 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 2 508 6.0E-63
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 22 498 6.0E-63
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 2 509 4.0E-55
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 7 471 2.0E-53
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 13 470 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 2 508 6.0E-63
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 22 498 6.0E-63
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 2 509 4.0E-55
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 7 471 2.0E-53
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 13 470 1.0E-46
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 16 472 7.0E-38
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 23 227 6.0E-26
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 26 476 2.0E-22
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 30 476 2.0E-19
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 14 494 6.0E-19
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 17 495 1.0E-18
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 17 233 1.0E-18
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 267 492 2.0E-18
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 17 495 8.0E-18
sp|P32482|CMLA_PSEAI Chloramphenicol resistance protein OS=Pseudomonas aeruginosa GN=cmlA PE=3 SV=2 63 223 2.0E-17
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 2 493 5.0E-17
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 61 495 8.0E-17
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 37 505 1.0E-15
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 43 501 1.0E-14
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 61 473 8.0E-14
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 15 507 4.0E-13
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 43 476 1.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 26 473 4.0E-12
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 61 492 6.0E-12
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 1 486 1.0E-11
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 68 479 2.0E-11
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 40 249 3.0E-11
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 31 444 7.0E-11
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 31 444 7.0E-11
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 68 479 9.0E-11
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 61 493 1.0E-10
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 2 476 1.0E-10
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 269 494 4.0E-09
sp|Q8C0T7|MFSD9_MOUSE Major facilitator superfamily domain-containing protein 9 OS=Mus musculus GN=Mfsd9 PE=2 SV=1 26 242 7.0E-09
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 52 202 2.0E-08
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 61 493 6.0E-08
sp|P31442|EMRD_ECOLI Multidrug resistance protein D OS=Escherichia coli (strain K12) GN=emrD PE=1 SV=2 62 223 2.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 2 353 2.0E-07
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 58 202 2.0E-07
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 52 225 2.0E-07
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 17 476 4.0E-07
sp|Q8NBP5|MFSD9_HUMAN Major facilitator superfamily domain-containing protein 9 OS=Homo sapiens GN=MFSD9 PE=2 SV=2 62 216 2.0E-06
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 54 202 2.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 58 202 4.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 58 202 4.0E-06
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 39 202 4.0E-06
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 58 202 4.0E-06
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 58 202 4.0E-06
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 58 202 4.0E-06
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 58 202 4.0E-06
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 40 476 5.0E-06
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 58 202 5.0E-06
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 58 202 5.0E-06
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 58 202 5.0E-06
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 58 202 6.0E-06
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 58 202 6.0E-06
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 58 202 6.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 58 202 6.0E-06
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 43 222 6.0E-06
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 58 202 6.0E-06
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 58 202 6.0E-06
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 58 202 6.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 16 488 6.0E-06
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 78 217 7.0E-06
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 12 476 7.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 58 202 7.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 58 202 7.0E-06
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 58 202 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 79 101 22
3 111 129 18
4 136 158 22
5 168 190 22
6 197 219 22
7 282 304 22
8 316 338 22
9 369 391 22
10 403 425 22
11 461 483 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4219
MDVDICQAQHPPDNADPERPCRPEHEDSFDSDPPYSAFSRPTRRWIMAMVTISSIVSPTTASIYFPVLNAVADSL
DVSISLINLTLTTYMVMQGLSPTVFGDFGDMAGRRPAFTVAFTIYLFANVGLALQRNYAALLVLRCLQSAGSSGT
LALSYAVVADLASPCERGVYMGFINAGATLGPALGPVLGGILGQSFGWPSIFCFCAVFVSVWLVPWILWVPETCR
AVVGNGSVPPPPWNMTLVDLIRCRGQNQRPETAPKVHLRLPNPLRTLHVVFRKEEGLILLVSAIIYLNFILVSAT
LSTIFRTIYQYNELEVGLCYLPYGIGSCLASLVQGYVVDWNYRRIARRRGDLAVGRTKREDLIAFPIETARIQLV
YPALLVGAVALIGWGWALEAETNVAVPLVLLFVIGMLVPTSFSVLNTLIVDLNPDATATAAAANNLVRCSFGAAA
TAVIQYMLNAMGRGWCFTLLALLMVACFAGLRVLEKCGPRWRAERAGRTRERESRTRSLEK*
Coding >Ophun1|4219
ATGGACGTCGATATCTGTCAGGCCCAACACCCTCCCGACAACGCCGATCCGGAGCGGCCCTGTCGTCCGGAGCAT
GAGGACTCGTTCGACTCCGATCCGCCGTATAGCGCCTTCTCGCGCCCAACCCGGAGATGGATCATGGCCATGGTG
ACCATCTCGAGCATCGTCTCGCCCACGACGGCCAGCATCTACTTTCCCGTCCTCAACGCAGTGGCCGACAGCCTC
GACGTCTCCATCTCGCTCATCAACCTCACGCTGACGACTTACATGGTCATGCAGGGCCTGTCGCCCACCGTCTTT
GGCGACTTTGGCGACATGGCCGGTCGAAGGCCCGCCTTTACCGTCGCCTTCACCATCTACCTGTTCGCCAACGTC
GGCCTCGCCCTGCAGCGCAACTACGCCGCCCTTCTCGTCCTCCGCTGCCTGCAGTCGGCCGGCAGTAGCGGTACG
CTGGCTCTCAGTTATGCCGTCGTTGCCGACTTGGCCTCTCCCTGCGAGAGGGGCGTCTACATGGGCTTCATCAAC
GCCGGCGCCACCCTCGGCCCAGCCTTGGGACCGGTTCTCGGAGGCATCCTGGGCCAATCTTTTGGGTGGCCGTCC
ATCTTTTGCTTCTGTGCCGTCTTCGTCTCTGTTTGGCTCGTCCCCTGGATCTTGTGGGTGCCGGAGACGTGCCGG
GCCGTCGTCGGCAACGGCTCCGTTCCGCCGCCGCCATGGAACATGACCCTGGTCGACCTGATCCGCTGCCGAGGT
CAAAATCAACGGCCAGAAACGGCGCCCAAGGTCCACTTGCGGCTCCCAAACCCACTGCGGACGCTTCACGTCGTC
TTCCGTAAGGAGGAGGGCCTCATCTTACTCGTATCCGCCATCATCTATCTCAACTTCATCCTCGTATCCGCCACG
CTGTCGACCATCTTCAGAACCATCTATCAGTACAATGAGCTCGAGGTCGGCCTCTGCTACCTACCCTACGGTATC
GGCTCTTGCCTGGCCAGCCTCGTTCAAGGTTACGTCGTCGACTGGAACTATCGCAGGATCGCCCGCCGACGGGGC
GACTTGGCGGTGGGCCGTACCAAGAGGGAGGACCTCATCGCATTTCCCATTGAAACGGCCCGCATCCAGCTCGTC
TATCCCGCCTTGCTGGTAGGAGCCGTCGCCCTCATCGGCTGGGGATGGGCTCTAGAGGCTGAGACGAATGTGGCC
GTGCCGCTGGTGCTCCTCTTCGTCATCGGGATGCTCGTGCCGACCTCGTTCAGCGTGCTAAACACGCTCATCGTC
GACCTTAACCCGGACGCCACAGCCACTGCCGCGGCTGCCAATAACTTGGTACGCTGCTCTTTTGGTGCCGCCGCC
ACGGCCGTCATCCAGTACATGCTCAACGCCATGGGTCGGGGCTGGTGCTTTACCTTGCTGGCCCTACTCATGGTA
GCCTGCTTCGCCGGTCTGAGAGTATTGGAGAAATGCGGTCCACGCTGGAGGGCTGAAAGGGCTGGCCGCACTCGG
GAGAGGGAAAGCCGGACTAGGTCACTGGAGAAGTAA
Transcript >Ophun1|4219
ATGGACGTCGATATCTGTCAGGCCCAACACCCTCCCGACAACGCCGATCCGGAGCGGCCCTGTCGTCCGGAGCAT
GAGGACTCGTTCGACTCCGATCCGCCGTATAGCGCCTTCTCGCGCCCAACCCGGAGATGGATCATGGCCATGGTG
ACCATCTCGAGCATCGTCTCGCCCACGACGGCCAGCATCTACTTTCCCGTCCTCAACGCAGTGGCCGACAGCCTC
GACGTCTCCATCTCGCTCATCAACCTCACGCTGACGACTTACATGGTCATGCAGGGCCTGTCGCCCACCGTCTTT
GGCGACTTTGGCGACATGGCCGGTCGAAGGCCCGCCTTTACCGTCGCCTTCACCATCTACCTGTTCGCCAACGTC
GGCCTCGCCCTGCAGCGCAACTACGCCGCCCTTCTCGTCCTCCGCTGCCTGCAGTCGGCCGGCAGTAGCGGTACG
CTGGCTCTCAGTTATGCCGTCGTTGCCGACTTGGCCTCTCCCTGCGAGAGGGGCGTCTACATGGGCTTCATCAAC
GCCGGCGCCACCCTCGGCCCAGCCTTGGGACCGGTTCTCGGAGGCATCCTGGGCCAATCTTTTGGGTGGCCGTCC
ATCTTTTGCTTCTGTGCCGTCTTCGTCTCTGTTTGGCTCGTCCCCTGGATCTTGTGGGTGCCGGAGACGTGCCGG
GCCGTCGTCGGCAACGGCTCCGTTCCGCCGCCGCCATGGAACATGACCCTGGTCGACCTGATCCGCTGCCGAGGT
CAAAATCAACGGCCAGAAACGGCGCCCAAGGTCCACTTGCGGCTCCCAAACCCACTGCGGACGCTTCACGTCGTC
TTCCGTAAGGAGGAGGGCCTCATCTTACTCGTATCCGCCATCATCTATCTCAACTTCATCCTCGTATCCGCCACG
CTGTCGACCATCTTCAGAACCATCTATCAGTACAATGAGCTCGAGGTCGGCCTCTGCTACCTACCCTACGGTATC
GGCTCTTGCCTGGCCAGCCTCGTTCAAGGTTACGTCGTCGACTGGAACTATCGCAGGATCGCCCGCCGACGGGGC
GACTTGGCGGTGGGCCGTACCAAGAGGGAGGACCTCATCGCATTTCCCATTGAAACGGCCCGCATCCAGCTCGTC
TATCCCGCCTTGCTGGTAGGAGCCGTCGCCCTCATCGGCTGGGGATGGGCTCTAGAGGCTGAGACGAATGTGGCC
GTGCCGCTGGTGCTCCTCTTCGTCATCGGGATGCTCGTGCCGACCTCGTTCAGCGTGCTAAACACGCTCATCGTC
GACCTTAACCCGGACGCCACAGCCACTGCCGCGGCTGCCAATAACTTGGTACGCTGCTCTTTTGGTGCCGCCGCC
ACGGCCGTCATCCAGTACATGCTCAACGCCATGGGTCGGGGCTGGTGCTTTACCTTGCTGGCCCTACTCATGGTA
GCCTGCTTCGCCGGTCTGAGAGTATTGGAGAAATGCGGTCCACGCTGGAGGGCTGAAAGGGCTGGCCGCACTCGG
GAGAGGGAAAGCCGGACTAGGTCACTGGAGAAGTAA
Gene >Ophun1|4219
ATGGACGTCGATATCTGTCAGGCCCAACACCCTCCCGACAACGCCGATCCGGAGCGGCCCTGTCGTCCGGAGCAT
GAGGACTCGTTCGACTCCGATCCGCCGTATAGCGCCTTCTCGCGCCCAACCCGGAGATGGATCATGGCCATGGTG
ACCATCTCGAGCATCGTCTCGCCCACGACGGCCAGCATCTACTTTCCCGTCCTCAACGCAGTGGCCGACAGCCTC
GACGTCTCCATCTCGCTCATCAACCTCACGCTGACGACTTACATGGTCATGCAGGGCCTGTCGCCCACCGTCTTT
GGCGACTTTGGCGACATGGCCGGTCGAAGGCCCGCCTTTACCGTCGCCTTCACCATCTACCTGTTCGCCAACGTC
GGCCTCGCCCTGCAGCGCAACTACGCCGCCCTTCTCGTCCTCCGCTGCCTGCAGTCGGCCGGCAGTAGCGGTACG
CTGGCTCTCAGTTATGCCGTCGTTGCCGACTTGGCCTCTCCCTGCGAGAGGGGCGTCTACATGGGCTTCATCAAC
GCCGGCGCCACCCTCGGCCCAGCCTTGGGACCGGTTCTCGGAGGCATCCTGGGCCAATCTTTTGGGTGGCCGTCC
ATCTTTTGCTTCTGTGCCGTCTTCGTCTCTGTTTGGCTCGTCCCCTGGATCTTGTGGGTGCCGGAGACGTGCCGG
GCCGTCGTCGGCAACGGCTCCGTTCCGCCGCCGCCATGGAACATGACCCTGGTCGACCTGATCCGCTGCCGAGGT
CAAAATCAACGGCCAGAAACGGCGCCCAAGGTCCACTTGCGGCTCCCAAACCCACTGCGGACGCTTCACGTCGTC
TTCCGTAAGGAGGAGGGCCTCATCTTACTCGTATCCGCCATCATCTATCTCAACTTCATCCTCGTATCCGCCACG
CTGTCGACCATCTTCAGAACCATCTATCAGTACAATGAGCTCGAGGTCGGCCTCTGCTACCTACCCTACGGTATC
GGCTCTTGCCTGGCCAGCCTCGTTCAAGGTTACGTCGTCGACTGGAACTATCGCAGGATCGCCCGCCGACGGGGC
GACTTGGCGGTGGGCCGTACCAAGAGGGAGGACCTCATCGCATTTCCCATTGAAACGGCCCGCATCCAGCTCGTC
TATCCCGCCTTGCTGGTAGGAGCCGTCGCCCTCATCGGCTGGGGATGGGCTCTAGAGGCTGAGACGAATGTGGCC
GTGCCGCTGGTGCTCCTCTTCGTCATCGGGATGCTCGTGCCGACCTCGTTCAGCGTGCTAAACACGCTCATCGTC
GACCTTAACCCGGACGCCACAGCCACTGCCGCGGCTGCCAATAACTTGGTACGCTGCTCTTTTGGTGCCGCCGCC
ACGGCCGTCATCCAGTACATGCTCAACGCCATGGGTCGGGGCTGGTGCTTTACCTTGCTGGCCCTACTCATGGTA
GCCTGCTTCGCCGGTCTGAGAGTATTGGAGAAATGCGGTCCACGCTGGAGGGCTGAAAGGGCTGGCCGCACTCGG
GAGAGGGAAAGCCGGACTAGGTCACTGGAGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail