Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4212
Gene name
LocationContig_388:13137..16532
Strand-
Gene length (bp)3395
Transcript length (bp)3210
Coding sequence length (bp)3210
Protein length (aa) 1070

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16187 Peptidase_M16_M Middle or third domain of peptidase_M16 3.9E-97 407 694
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 2.2E-19 221 400
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 6.4E-13 700 881
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 1.8E-31 46 195

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=IDE PE=2 SV=1 30 953 0.0E+00
sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens GN=IDE PE=1 SV=4 20 953 0.0E+00
sp|P35559|IDE_RAT Insulin-degrading enzyme OS=Rattus norvegicus GN=Ide PE=1 SV=1 20 953 0.0E+00
sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=Ide PE=1 SV=1 20 953 0.0E+00
sp|Q06010|STE23_YEAST A-factor-processing enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE23 PE=1 SV=2 26 953 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q24K02|IDE_BOVIN Insulin-degrading enzyme OS=Bos taurus GN=IDE PE=2 SV=1 30 953 0.0E+00
sp|P14735|IDE_HUMAN Insulin-degrading enzyme OS=Homo sapiens GN=IDE PE=1 SV=4 20 953 0.0E+00
sp|P35559|IDE_RAT Insulin-degrading enzyme OS=Rattus norvegicus GN=Ide PE=1 SV=1 20 953 0.0E+00
sp|Q9JHR7|IDE_MOUSE Insulin-degrading enzyme OS=Mus musculus GN=Ide PE=1 SV=1 20 953 0.0E+00
sp|Q06010|STE23_YEAST A-factor-processing enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE23 PE=1 SV=2 26 953 0.0E+00
sp|P22817|IDE_DROME Insulin-degrading enzyme OS=Drosophila melanogaster GN=Ide PE=1 SV=4 3 957 0.0E+00
sp|O22941|PXM16_ARATH Zinc-metallopeptidase, peroxisomal OS=Arabidopsis thaliana GN=PXM16 PE=2 SV=1 26 975 0.0E+00
sp|O14077|MU138_SCHPO Putative zinc protease mug138 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug138 PE=1 SV=1 17 950 0.0E+00
sp|Q5R4H6|NRDC_PONAB Nardilysin OS=Pongo abelii GN=NRD1 PE=2 SV=1 55 959 2.0E-132
sp|Q8BHG1|NRDC_MOUSE Nardilysin OS=Mus musculus GN=Nrd1 PE=1 SV=1 55 959 9.0E-132
sp|O43847|NRDC_HUMAN Nardilysin OS=Homo sapiens GN=NRD1 PE=1 SV=2 55 959 4.0E-131
sp|P47245|NRDC_RAT Nardilysin OS=Rattus norvegicus GN=Nrd1 PE=1 SV=1 55 959 5.0E-129
sp|Q54JQ2|IDE_DICDI Insulin-degrading enzyme homolog OS=Dictyostelium discoideum GN=DDB_G0287851 PE=3 SV=1 30 954 1.0E-87
sp|Q10040|YQA4_CAEEL Putative zinc protease C28F5.4 OS=Caenorhabditis elegans GN=C28F5.4 PE=3 SV=2 12 409 2.0E-84
sp|Q8ZMB5|PTRA_SALTY Protease 3 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ptrA PE=3 SV=1 20 934 4.0E-84
sp|Q8Z418|PTRA_SALTI Protease 3 OS=Salmonella typhi GN=ptrA PE=3 SV=1 20 934 3.0E-82
sp|Q8CVS2|PTRA_ECOL6 Protease 3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ptrA PE=3 SV=1 20 934 5.0E-82
sp|Q83QC3|PTRA_SHIFL Protease 3 OS=Shigella flexneri GN=ptrA PE=3 SV=1 20 934 9.0E-82
sp|P05458|PTRA_ECOLI Protease 3 OS=Escherichia coli (strain K12) GN=ptrA PE=1 SV=1 20 934 2.0E-81
sp|Q8X6M8|PTRA_ECO57 Protease 3 OS=Escherichia coli O157:H7 GN=ptrA PE=3 SV=1 20 934 1.0E-80
sp|P42789|SDP_EIMBO Sporozoite developmental protein OS=Eimeria bovis PE=2 SV=1 1 570 6.0E-48
sp|P40851|AXL1_YEAST Putative protease AXL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AXL1 PE=1 SV=2 28 378 2.0E-40
sp|Q10040|YQA4_CAEEL Putative zinc protease C28F5.4 OS=Caenorhabditis elegans GN=C28F5.4 PE=3 SV=2 514 950 6.0E-33
sp|Q88QV3|PQQF_PSEPK Coenzyme PQQ synthesis protein F OS=Pseudomonas putida (strain KT2440) GN=pqqF PE=3 SV=1 35 345 1.0E-20
sp|Q9I2D2|PQQF_PSEAE Coenzyme PQQ synthesis protein F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqqF PE=3 SV=1 39 338 1.0E-16
sp|P55174|PQQF_PSEPH Coenzyme PQQ synthesis protein F OS=Pseudomonas protegens (strain DSM 19095 / CHA0) GN=pqqF PE=3 SV=1 47 251 2.0E-15
sp|P27508|PQQF_KLEPN Coenzyme PQQ synthesis protein F OS=Klebsiella pneumoniae GN=pqqF PE=3 SV=1 35 250 4.0E-14
sp|Q88A79|PQQF_PSESM Coenzyme PQQ synthesis protein F OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pqqF PE=3 SV=1 27 251 1.0E-11
sp|P55679|Y4WA_RHISN Uncharacterized zinc protease y4wA OS=Rhizobium sp. (strain NGR234) GN=NGR_a01040 PE=3 SV=1 39 243 1.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup258
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6289
Ophiocordyceps australis 1348a (Ghana) OphauG2|6290
Ophiocordyceps australis map64 (Brazil) OphauB2|4366
Ophiocordyceps australis map64 (Brazil) OphauB2|4367
Ophiocordyceps camponoti-floridani Ophcf2|05034
Ophiocordyceps camponoti-rufipedis Ophun1|4211
Ophiocordyceps camponoti-rufipedis Ophun1|4212 (this protein)
Ophiocordyceps kimflemingae Ophio5|2102
Ophiocordyceps kimflemingae Ophio5|2103
Ophiocordyceps subramaniannii Hirsu2|1017
Ophiocordyceps subramaniannii Hirsu2|1018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4212
MPSPQSPGLAPGRRTPVVVLADCLEKPSLDDRDYRVVRLENELEALLVHDPETDKASAALDVNVGNFSDEEGMPG
MAHAVEHLLFMGTKKFPVENEYNQYLAANSGASNAYTASTSTNYFFDVAAKPANDEDPSDSNPSPLHGALDRFAQ
FFVEPLFLPSTLDRELKAVDSENKKNLQNDTWRLHQLGKSLSNPKHPFCHFSTGNLNVLKTQPEARGVNVRDKFI
EFHDKHYSANRMKLVVLGREPLDVLQKWVVELFSPIANKKLPPNRWSDEVPFRDCDLATQCFAKPVMDTRQLELT
FPFVDEEALFESQPSRYISHLIGHEGPGSIMSYVKNKGWVNGLSAWASSICPGTPGMFEVQIRLTEEGLKNYPEI
VKIFFQYVSLLREASPQEWIFDEQKGMAEVDFKFRQKTPASRFTSRTSSVMQKPLPREWLLSGNSRLRTFDAKLI
ENALSTIRPDKLRLMIVSRTFPGDWNAKEKWYGTEYRCEKIPDDLMAELNSAMELSASERLPELHLPHKNNFIPS
KLEVDKKEVAEPAPAPRVLRNDALARTWWKKDDTFWVPKANVMVSLKNPIIHATAENSVKARIFTELVRDEFEEY
SYDAELAGLQYTVSLDLRGLFLDISGYNDKLPLLLKQVVVTIRDLDIRTERFDIVKERLTRGYKNFQLQSSYQQI
GDYVSWLNAERDYVVEELEAELKGITVDAVRLFHRQMLAQLYVEIYAHGNLYRDEALMVTDMVVSTFKARALPRW
QCPIIRSLTLPPGSNFVFNKTLEDPANVNHCVETWLSVGDRADGLARAKTLLIDQMTHEPAFDQLRTKEQLGYIV
FSGIRNFATTCGFRILIQSEKTPEYLENRIEAFLAQFGTILQSMSEAEFEGHKRSLIIRRLEKLRSLDQESSRHW
TQISNEYYDFEQAQVDAANIKPLTKADMVDFYNEYLSPSSSRRARLSVHLHARGAGELDLKVVELLRTSGLDEVP
QAKRSCLALLDGHLKDVVKVPTEKREVIIRQAKELGLDVTAQNAEYDGEESGQLAAGPAQEITDVRRHRAALPAS
RGARPAKELSEFEDTDAKL*
Coding >Ophun1|4212
ATGCCTTCGCCTCAGTCGCCTGGCTTGGCCCCGGGCCGCCGGACGCCCGTCGTCGTCTTGGCCGACTGCCTGGAG
AAGCCGTCGCTGGATGACCGCGACTACCGAGTCGTCAGGCTTGAGAACGAGCTAGAGGCTCTACTGGTTCACGAT
CCCGAGACGGACAAGGCCAGCGCTGCTCTCGATGTCAATGTTGGGAACTTCTCGGATGAGGAGGGCATGCCCGGC
ATGGCTCACGCCGTCGAACATCTCCTCTTCATGGGCACAAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTAT
CTCGCCGCCAACTCTGGCGCCTCAAACGCCTATACGGCCAGCACCTCTACCAATTACTTCTTCGATGTTGCCGCC
AAGCCGGCCAACGACGAGGATCCTTCCGATAGCAACCCCTCGCCCTTGCACGGTGCTCTCGATCGCTTTGCCCAG
TTCTTCGTCGAGCCCCTCTTCCTCCCCAGTACGCTCGACAGGGAGCTCAAGGCCGTGGATTCGGAGAACAAGAAA
AATCTTCAAAACGACACCTGGCGTCTCCATCAGCTCGGCAAGTCGCTGTCTAACCCCAAGCATCCTTTCTGCCAC
TTCTCCACCGGCAACCTCAATGTGCTCAAGACGCAGCCTGAAGCGAGGGGGGTGAATGTCCGGGACAAGTTCATT
GAGTTTCATGACAAGCACTACTCGGCCAATCGCATGAAGCTCGTCGTTCTCGGCCGCGAGCCGCTCGATGTTCTT
CAGAAATGGGTCGTCGAGCTGTTTTCGCCCATCGCCAACAAGAAGCTCCCGCCCAACAGGTGGTCTGACGAGGTT
CCCTTCCGCGACTGCGATCTGGCGACGCAGTGCTTCGCCAAGCCCGTCATGGACACGCGCCAGCTTGAACTGACC
TTTCCCTTCGTGGACGAGGAAGCTCTCTTTGAGTCGCAGCCCAGCAGGTACATTAGCCACCTCATCGGCCACGAA
GGTCCGGGGAGCATCATGTCGTACGTCAAGAACAAGGGCTGGGTTAATGGCCTATCAGCCTGGGCCTCGTCCATT
TGTCCCGGGACGCCGGGCATGTTTGAAGTTCAGATCCGCTTGACGGAAGAAGGTCTCAAGAATTATCCCGAGATT
GTCAAAATCTTCTTCCAGTACGTCTCGTTGCTGCGCGAGGCCTCGCCTCAGGAATGGATCTTCGACGAGCAAAAG
GGAATGGCCGAAGTGGACTTCAAGTTTAGGCAAAAGACGCCAGCTAGCCGATTCACCAGCAGAACGAGTTCCGTC
ATGCAGAAGCCTCTGCCGCGCGAGTGGCTGCTTAGTGGCAACAGCCGTCTGCGAACCTTTGACGCCAAGCTGATT
GAGAATGCACTGTCCACGATTCGTCCGGACAAGCTGCGCCTGATGATCGTGTCGAGGACGTTTCCCGGGGACTGG
AACGCAAAGGAGAAGTGGTACGGGACGGAATATCGCTGCGAGAAGATCCCCGACGATCTGATGGCCGAGCTGAAC
AGCGCCATGGAGCTGTCTGCGTCGGAGCGTCTTCCTGAGCTTCACCTGCCACACAAGAACAACTTTATACCCAGC
AAGCTCGAAGTGGACAAGAAGGAGGTGGCAGAGCCGGCACCGGCGCCGCGTGTGCTCCGCAACGATGCCCTCGCC
CGCACCTGGTGGAAGAAGGACGACACGTTTTGGGTTCCCAAGGCCAACGTCATGGTGAGCCTCAAGAATCCCATC
ATTCACGCGACGGCGGAGAACAGCGTCAAGGCGAGAATCTTCACCGAGCTCGTACGGGACGAGTTTGAGGAGTAC
TCGTACGATGCCGAGCTCGCCGGTCTGCAGTATACTGTATCCCTCGACTTGCGTGGCCTGTTCCTCGACATATCA
GGATACAACGACAAGCTTCCGCTCTTGCTCAAGCAGGTCGTCGTCACCATCCGCGATCTCGACATCAGGACGGAG
CGGTTTGACATTGTCAAGGAGCGTCTGACCCGGGGTTACAAGAACTTTCAGCTGCAGTCGTCCTATCAGCAGATT
GGCGACTACGTCTCTTGGCTCAACGCCGAGCGCGACTACGTCGTGGAGGAGCTCGAGGCAGAGCTCAAGGGCATC
ACCGTCGACGCTGTCAGGCTGTTCCATAGGCAGATGCTGGCCCAGCTGTACGTCGAGATTTACGCTCACGGGAAC
CTGTACCGGGACGAGGCCCTGATGGTGACGGACATGGTCGTTTCCACCTTCAAGGCGCGCGCGCTACCCAGGTGG
CAATGCCCCATCATCCGCTCGCTCACGCTGCCGCCAGGCTCCAACTTTGTCTTCAACAAGACGCTCGAGGATCCG
GCCAACGTCAACCACTGCGTCGAGACGTGGCTCTCCGTCGGCGACAGGGCTGACGGCCTCGCGCGCGCAAAGACG
TTGTTGATCGACCAGATGACGCATGAGCCCGCTTTTGACCAGCTCAGGACCAAGGAGCAGCTCGGATACATTGTC
TTTTCGGGCATTCGCAACTTTGCTACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAATAC
TTGGAGAATCGCATCGAGGCCTTCCTGGCGCAGTTTGGCACGATATTGCAGTCGATGAGCGAGGCCGAGTTTGAG
GGCCACAAGCGGAGTCTCATCATCAGGCGGCTGGAGAAGCTTAGGAGTCTCGACCAAGAGTCGTCGCGGCATTGG
ACTCAGATCAGCAACGAGTACTACGACTTTGAGCAAGCGCAAGTCGACGCTGCCAACATCAAGCCCCTGACCAAG
GCTGACATGGTGGACTTTTACAACGAGTATCTGAGCCCTTCGTCGAGCCGTCGGGCGCGGCTCTCGGTCCACCTA
CACGCCCGCGGTGCCGGCGAACTGGACCTGAAGGTGGTGGAACTCTTGCGGACGTCAGGTCTCGACGAGGTGCCG
CAAGCGAAGCGCTCGTGCCTGGCTCTGCTCGACGGCCATCTCAAGGACGTGGTCAAGGTGCCTACGGAGAAGAGG
GAGGTGATTATCCGTCAGGCCAAGGAGCTCGGGCTCGACGTGACGGCCCAGAACGCCGAGTATGACGGAGAGGAA
TCCGGGCAGCTGGCAGCGGGGCCGGCGCAGGAAATCACCGACGTGCGCCGGCACAGGGCGGCTCTGCCGGCAAGC
CGGGGCGCCAGACCGGCCAAGGAGCTGAGCGAGTTTGAGGACACGGACGCCAAGTTATGA
Transcript >Ophun1|4212
ATGCCTTCGCCTCAGTCGCCTGGCTTGGCCCCGGGCCGCCGGACGCCCGTCGTCGTCTTGGCCGACTGCCTGGAG
AAGCCGTCGCTGGATGACCGCGACTACCGAGTCGTCAGGCTTGAGAACGAGCTAGAGGCTCTACTGGTTCACGAT
CCCGAGACGGACAAGGCCAGCGCTGCTCTCGATGTCAATGTTGGGAACTTCTCGGATGAGGAGGGCATGCCCGGC
ATGGCTCACGCCGTCGAACATCTCCTCTTCATGGGCACAAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTAT
CTCGCCGCCAACTCTGGCGCCTCAAACGCCTATACGGCCAGCACCTCTACCAATTACTTCTTCGATGTTGCCGCC
AAGCCGGCCAACGACGAGGATCCTTCCGATAGCAACCCCTCGCCCTTGCACGGTGCTCTCGATCGCTTTGCCCAG
TTCTTCGTCGAGCCCCTCTTCCTCCCCAGTACGCTCGACAGGGAGCTCAAGGCCGTGGATTCGGAGAACAAGAAA
AATCTTCAAAACGACACCTGGCGTCTCCATCAGCTCGGCAAGTCGCTGTCTAACCCCAAGCATCCTTTCTGCCAC
TTCTCCACCGGCAACCTCAATGTGCTCAAGACGCAGCCTGAAGCGAGGGGGGTGAATGTCCGGGACAAGTTCATT
GAGTTTCATGACAAGCACTACTCGGCCAATCGCATGAAGCTCGTCGTTCTCGGCCGCGAGCCGCTCGATGTTCTT
CAGAAATGGGTCGTCGAGCTGTTTTCGCCCATCGCCAACAAGAAGCTCCCGCCCAACAGGTGGTCTGACGAGGTT
CCCTTCCGCGACTGCGATCTGGCGACGCAGTGCTTCGCCAAGCCCGTCATGGACACGCGCCAGCTTGAACTGACC
TTTCCCTTCGTGGACGAGGAAGCTCTCTTTGAGTCGCAGCCCAGCAGGTACATTAGCCACCTCATCGGCCACGAA
GGTCCGGGGAGCATCATGTCGTACGTCAAGAACAAGGGCTGGGTTAATGGCCTATCAGCCTGGGCCTCGTCCATT
TGTCCCGGGACGCCGGGCATGTTTGAAGTTCAGATCCGCTTGACGGAAGAAGGTCTCAAGAATTATCCCGAGATT
GTCAAAATCTTCTTCCAGTACGTCTCGTTGCTGCGCGAGGCCTCGCCTCAGGAATGGATCTTCGACGAGCAAAAG
GGAATGGCCGAAGTGGACTTCAAGTTTAGGCAAAAGACGCCAGCTAGCCGATTCACCAGCAGAACGAGTTCCGTC
ATGCAGAAGCCTCTGCCGCGCGAGTGGCTGCTTAGTGGCAACAGCCGTCTGCGAACCTTTGACGCCAAGCTGATT
GAGAATGCACTGTCCACGATTCGTCCGGACAAGCTGCGCCTGATGATCGTGTCGAGGACGTTTCCCGGGGACTGG
AACGCAAAGGAGAAGTGGTACGGGACGGAATATCGCTGCGAGAAGATCCCCGACGATCTGATGGCCGAGCTGAAC
AGCGCCATGGAGCTGTCTGCGTCGGAGCGTCTTCCTGAGCTTCACCTGCCACACAAGAACAACTTTATACCCAGC
AAGCTCGAAGTGGACAAGAAGGAGGTGGCAGAGCCGGCACCGGCGCCGCGTGTGCTCCGCAACGATGCCCTCGCC
CGCACCTGGTGGAAGAAGGACGACACGTTTTGGGTTCCCAAGGCCAACGTCATGGTGAGCCTCAAGAATCCCATC
ATTCACGCGACGGCGGAGAACAGCGTCAAGGCGAGAATCTTCACCGAGCTCGTACGGGACGAGTTTGAGGAGTAC
TCGTACGATGCCGAGCTCGCCGGTCTGCAGTATACTGTATCCCTCGACTTGCGTGGCCTGTTCCTCGACATATCA
GGATACAACGACAAGCTTCCGCTCTTGCTCAAGCAGGTCGTCGTCACCATCCGCGATCTCGACATCAGGACGGAG
CGGTTTGACATTGTCAAGGAGCGTCTGACCCGGGGTTACAAGAACTTTCAGCTGCAGTCGTCCTATCAGCAGATT
GGCGACTACGTCTCTTGGCTCAACGCCGAGCGCGACTACGTCGTGGAGGAGCTCGAGGCAGAGCTCAAGGGCATC
ACCGTCGACGCTGTCAGGCTGTTCCATAGGCAGATGCTGGCCCAGCTGTACGTCGAGATTTACGCTCACGGGAAC
CTGTACCGGGACGAGGCCCTGATGGTGACGGACATGGTCGTTTCCACCTTCAAGGCGCGCGCGCTACCCAGGTGG
CAATGCCCCATCATCCGCTCGCTCACGCTGCCGCCAGGCTCCAACTTTGTCTTCAACAAGACGCTCGAGGATCCG
GCCAACGTCAACCACTGCGTCGAGACGTGGCTCTCCGTCGGCGACAGGGCTGACGGCCTCGCGCGCGCAAAGACG
TTGTTGATCGACCAGATGACGCATGAGCCCGCTTTTGACCAGCTCAGGACCAAGGAGCAGCTCGGATACATTGTC
TTTTCGGGCATTCGCAACTTTGCTACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAATAC
TTGGAGAATCGCATCGAGGCCTTCCTGGCGCAGTTTGGCACGATATTGCAGTCGATGAGCGAGGCCGAGTTTGAG
GGCCACAAGCGGAGTCTCATCATCAGGCGGCTGGAGAAGCTTAGGAGTCTCGACCAAGAGTCGTCGCGGCATTGG
ACTCAGATCAGCAACGAGTACTACGACTTTGAGCAAGCGCAAGTCGACGCTGCCAACATCAAGCCCCTGACCAAG
GCTGACATGGTGGACTTTTACAACGAGTATCTGAGCCCTTCGTCGAGCCGTCGGGCGCGGCTCTCGGTCCACCTA
CACGCCCGCGGTGCCGGCGAACTGGACCTGAAGGTGGTGGAACTCTTGCGGACGTCAGGTCTCGACGAGGTGCCG
CAAGCGAAGCGCTCGTGCCTGGCTCTGCTCGACGGCCATCTCAAGGACGTGGTCAAGGTGCCTACGGAGAAGAGG
GAGGTGATTATCCGTCAGGCCAAGGAGCTCGGGCTCGACGTGACGGCCCAGAACGCCGAGTATGACGGAGAGGAA
TCCGGGCAGCTGGCAGCGGGGCCGGCGCAGGAAATCACCGACGTGCGCCGGCACAGGGCGGCTCTGCCGGCAAGC
CGGGGCGCCAGACCGGCCAAGGAGCTGAGCGAGTTTGAGGACACGGACGCCAAGTTATGA
Gene >Ophun1|4212
ATGCCTTCGCCTCAGTCGCCTGGCTTGGCCCCGGGCCGCCGGACGCCCGTCGTCGTCTTGGCCGACTGCCTGGAG
AAGCCGTCGCTGGATGACCGCGACTACCGAGTCGTCAGGCTTGAGAACGAGCTAGAGGCTCTACTGGTTCACGAT
CCCGAGACGGACAAGGCCAGCGCTGCTCTCGATGTCAATGTTGGGAACTTCTCGGATGAGGAGGGCATGCCCGGC
ATGGCTCACGCCGTCGAACATGTACGACACAATTTCTTCCGTCTCATCATCATCATCGTCTTGCTCTTTCGTCGA
GTGCTGACCAAGGCTCTAGCTCCTCTTCATGGGCACAAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTATCT
CGCCGCCAACTCTGGCGCCTCAAACGCCTATACGGCCAGCACCTCTACCAATTACTTCTTCGATGTTGCCGCCAA
GCCGGCCAACGACGAGGATCCTTCCGATAGCAACCCCTCGCCCTTGCACGGTGCTCTCGATCGCTTTGCCCAGTT
CTTCGTCGAGCCCCTCTTCCTCCCCAGTACGCTCGACAGGGAGCTCAAGGCCGTGGATTCGGAGAACAAGAAAAA
TCTTCAAAACGACACCTGGCGTCTCCATCAGCTCGGCAAGTCGCTGTCTAACCCCAAGCATCCTTTCTGCCACTT
CTCCACCGGCAACCTCAATGTGCTCAAGACGCAGCCTGAAGCGAGGGGGGTGAATGTCCGGGACAAGTTCATTGA
GTTTCATGACAAGCACTACTCGGCCAATCGCATGAAGCTCGTCGTTCTCGGCCGCGAGCCGCTCGATGTTCTTCA
GAAATGGGTCGTCGAGCTGTTTTCGCCCATCGCCAACAAGAAGCTCCCGCCCAACAGGTGGTCTGACGAGGTTCC
CTTCCGCGACTGCGATCTGGCGACGCAGTGCTTCGCCAAGCCCGTCATGGACACGCGCCAGCTTGAACTGACCTT
TCCCTTCGTGGACGAGGAAGCTCTCTTTGAGTCGCAGCCCAGCAGGTACATTAGCCACCTCATCGGCCACGAAGG
TCCGGGGAGCATCATGTCGTACGTCAAGAACAAGGGCTGGGTTAATGGCCTATCAGCCTGGGCCTCGTCCATTTG
TCCCGGGACGCCGGGCATGTTTGAAGTTCAGATCCGCTTGACGGAAGAAGTATGCCGCCTCTCTTTTTATCCTGC
GGCGGCTCATCGACACTGACATCTTAGCTTAGGGTCTCAAGAATTATCCCGAGATTGTCAAAATCTTCTTCCAGT
ACGTCTCGTTGCTGCGCGAGGCCTCGCCTCAGGAATGGATCTTCGACGAGCAAAAGGGAATGGCCGAAGTGGACT
TCAAGTTTAGGCAAAAGACGCCAGCTAGCCGATTCACCAGCAGAACGAGTTCCGTCATGCAGAAGCCTCTGCCGC
GCGAGTGGCTGCTTAGTGGCAACAGCCGTCTGCGAACCTTTGACGCCAAGCTGATTGAGAATGCACTGTCCACGA
TTCGTCCGGACAAGCTGCGCCTGATGATCGTGTCGAGGACGTTTCCCGGGGACTGGAACGCAAAGGAGAAGTGGT
ACGGGACGGAATATCGCTGCGAGAAGATCCCCGACGATCTGATGGCCGAGCTGAACAGCGCCATGGAGCTGTCTG
CGTCGGAGCGTCTTCCTGAGCTTCACCTGCCACACAAGAACAACTTTATACCCAGCAAGCTCGAAGTGGACAAGA
AGGAGGTGGCAGAGCCGGCACCGGCGCCGCGTGTGCTCCGCAACGATGCCCTCGCCCGCACCTGGTGGAAGAAGG
ACGACACGTTTTGGGTTCCCAAGGCCAACGTCATGGTGAGCCTCAAGAATCCCATCATTCACGCGACGGCGGAGA
ACAGCGTCAAGGCGAGAATCTTCACCGAGCTCGTACGGGACGAGTTTGAGGAGTACTCGTACGATGCCGAGCTCG
CCGGTCTGCAGTATACTGTATCCCTCGACTTGCGTGGCCTGTTCCTCGACATATCAGGATACAACGACAAGCTTC
CGCTCTTGCTCAAGCAGGTCGTCGTCACCATCCGCGATCTCGACATCAGGACGGAGCGGTTTGACATTGTCAAGG
AGCGTCTGACCCGGGGTTACAAGAACTTTCAGCTGCAGTCGTCCTATCAGCAGATTGGCGACTACGTCTCTTGGC
TCAACGCCGAGCGCGACTACGTCGTGGAGGAGCTCGAGGCAGAGCTCAAGGGCATCACCGTCGACGCTGTCAGGC
TGTTCCATAGGCAGATGCTGGCCCAGCTGTACGTCGAGATTTACGCTCACGGGAACCTGTACCGGGACGAGGCCC
TGATGGTGACGGACATGGTCGTTTCCACCTTCAAGGCGCGCGCGCTACCCAGGTGGCAATGCCCCATCATCCGCT
CGCTCACGCTGCCGCCAGGCTCCAACTTTGTCTTCAACAAGACGCTCGAGGATCCGGCCAACGTCAACCACTGCG
TCGAGACGTGGCTCTCCGTCGGCGACAGGGCTGACGGCCTCGCGCGCGCAAAGACGTTGTTGATCGACCAGATGA
CGCATGAGCCCGCTTTTGACCAGCTCAGGACCAAGGAGCAGCTCGGATACATTGTCTTTTCGGGCATTCGCAACT
TTGCTACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAATACTTGGAGAATCGCATCGAGG
CCTTCCTGGCGCAGTTTGGCACGATATTGCAGTCGATGAGCGAGGCCGAGTTTGAGGGCCACAAGCGGAGTCTCA
TCATCAGGCGGCTGGAGAAGCTTAGGAGTCTCGACCAAGAGTCGTCGCGGCATTGGACTCAGATCAGCAACGAGT
ACTACGACTTTGAGCAAGGTGCGTGAAAGCAAGAAGACAAGGTCGGGTGGAACTGGCTGACGTGATGAATAGCGC
AAGTCGACGCTGCCAACATCAAGCCCCTGACCAAGGCTGACATGGTGGACTTTTACAACGAGTATCTGAGCCCTT
CGTCGAGCCGTCGGGCGCGGCTCTCGGTCCACCTACACGCCCGCGGTGCCGGCGAACTGGACCTGAAGGTGGTGG
AACTCTTGCGGACGTCAGGTCTCGACGAGGTGCCGCAAGCGAAGCGCTCGTGCCTGGCTCTGCTCGACGGCCATC
TCAAGGACGTGGTCAAGGTGCCTACGGAGAAGAGGGAGGTGATTATCCGTCAGGCCAAGGAGCTCGGGCTCGACG
TGACGGCCCAGAACGCCGAGTATGACGGAGAGGAATCCGGGCAGCTGGCAGCGGGGCCGGCGCAGGAAATCACCG
ACGTGCGCCGGCACAGGGCGGCTCTGCCGGCAAGCCGGGGCGCCAGACCGGCCAAGGAGCTGAGCGAGTTTGAGG
ACACGGACGCCAAGTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail