Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4211
Gene name
LocationContig_388:7458..12744
Strand-
Gene length (bp)5286
Transcript length (bp)4584
Coding sequence length (bp)4584
Protein length (aa) 1528

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 3.4E-75 526 1348
PF06337 DUSP DUSP domain 6.9E-09 212 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 175 799 8.0E-74
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 524 790 1.0E-66
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 513 794 5.0E-60
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 524 952 2.0E-59
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 524 877 3.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 175 799 8.0E-74
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 524 790 1.0E-66
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 513 794 5.0E-60
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 524 952 2.0E-59
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 524 877 3.0E-59
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 524 877 1.0E-58
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 524 952 1.0E-58
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 518 790 1.0E-58
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 518 790 1.0E-58
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 518 790 3.0E-58
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 518 790 7.0E-58
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 524 775 2.0E-57
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 518 790 5.0E-56
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 524 790 3.0E-55
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 510 795 4.0E-54
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 524 775 5.0E-54
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 520 921 2.0E-53
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 520 921 4.0E-53
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 524 804 1.0E-51
sp|O22207|UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana GN=UBP5 PE=1 SV=2 520 777 5.0E-49
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 524 787 2.0E-48
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 524 765 3.0E-48
sp|Q6J1Y9|UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus GN=Usp19 PE=1 SV=1 522 799 2.0E-45
sp|Q3UJD6|UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus GN=Usp19 PE=1 SV=1 522 799 4.0E-45
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 1195 1351 8.0E-45
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 1133 1351 1.0E-44
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 1133 1351 2.0E-44
sp|O94966|UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens GN=USP19 PE=1 SV=2 502 781 2.0E-44
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 1195 1351 6.0E-44
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 1195 1351 9.0E-43
sp|O60079|UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp12 PE=1 SV=1 1147 1353 1.0E-42
sp|P39538|UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP12 PE=1 SV=1 1140 1367 1.0E-42
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 1185 1350 6.0E-42
sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 1147 1350 8.0E-42
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=2 SV=2 1197 1350 3.0E-41
sp|O22207|UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana GN=UBP5 PE=1 SV=2 1200 1354 3.0E-41
sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 1147 1350 7.0E-41
sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=2 SV=2 1130 1355 1.0E-38
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 1197 1351 2.0E-38
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 1199 1351 4.0E-38
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 1202 1351 5.0E-38
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 1199 1351 5.0E-38
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 1202 1351 6.0E-38
sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 1199 1351 9.0E-37
sp|Q6J1Y9|UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus GN=Usp19 PE=1 SV=1 1202 1373 3.0E-36
sp|Q3UJD6|UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus GN=Usp19 PE=1 SV=1 1202 1359 6.0E-36
sp|O94966|UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens GN=USP19 PE=1 SV=2 1202 1359 6.0E-36
sp|Q01988|UBP11_CANLF Ubiquitin carboxyl-terminal hydrolase 11 (Fragment) OS=Canis lupus familiaris GN=USP11 PE=2 SV=1 1199 1351 8.0E-36
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 526 718 8.0E-36
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 522 714 1.0E-35
sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=1 SV=4 1199 1354 5.0E-35
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 526 718 2.0E-34
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 524 711 6.0E-33
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 1192 1355 6.0E-33
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 524 711 7.0E-33
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 524 711 1.0E-32
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 524 711 1.0E-32
sp|P32571|UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA4 PE=1 SV=2 522 715 3.0E-32
sp|A6ZY34|UBP4_YEAS7 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DOA4 PE=3 SV=1 522 715 4.0E-32
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 522 712 6.0E-32
sp|B3LGK1|UBP4_YEAS1 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DOA4 PE=3 SV=1 522 715 7.0E-32
sp|A7TGY3|UBP4_VANPO Ubiquitin carboxyl-terminal hydrolase 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DOA4 PE=3 SV=1 522 715 2.0E-31
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 1202 1355 5.0E-31
sp|Q754R5|UBP4_ASHGO Ubiquitin carboxyl-terminal hydrolase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DOA4 PE=3 SV=2 519 718 3.0E-30
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 1203 1365 2.0E-29
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 1203 1366 3.0E-29
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 492 713 2.0E-28
sp|Q9USM5|UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp1 PE=3 SV=1 1198 1352 6.0E-28
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 1202 1352 8.0E-28
sp|Q70CQ4|UBP31_HUMAN Ubiquitin carboxyl-terminal hydrolase 31 OS=Homo sapiens GN=USP31 PE=2 SV=2 524 781 2.0E-27
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 1202 1352 3.0E-27
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 1202 1352 6.0E-27
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 1202 1352 6.0E-27
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 1202 1348 7.0E-27
sp|P39944|UBP5_YEAST Ubiquitin carboxyl-terminal hydrolase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP5 PE=1 SV=1 522 712 1.0E-26
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 1176 1348 1.0E-26
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 1202 1352 2.0E-26
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 1202 1352 7.0E-26
sp|B1WBD7|UBP20_XENLA Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus laevis GN=usp20 PE=2 SV=1 1202 1352 9.0E-26
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 524 716 1.0E-25
sp|O60139|UBP4_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp4 PE=1 SV=2 526 711 2.0E-25
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 524 716 4.0E-25
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 524 716 5.0E-25
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 1176 1351 7.0E-25
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 1202 1352 1.0E-24
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 1202 1352 1.0E-24
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 1202 1352 2.0E-24
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 1202 1352 2.0E-24
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 524 716 3.0E-24
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 1202 1352 4.0E-24
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 1122 1348 1.0E-23
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 1202 1348 4.0E-23
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 1202 1348 3.0E-22
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 1202 1350 4.0E-22
sp|Q5UQR3|UBPL1_MIMIV Probable ubiquitin carboxyl-terminal hydrolase R319 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R319 PE=3 SV=1 1200 1350 1.0E-21
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 1202 1348 5.0E-21
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 524 714 1.0E-20
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 1203 1348 1.0E-20
sp|A7TGY3|UBP4_VANPO Ubiquitin carboxyl-terminal hydrolase 4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DOA4 PE=3 SV=1 1198 1350 2.0E-20
sp|Q70EL4|UBP43_HUMAN Ubiquitin carboxyl-terminal hydrolase 43 OS=Homo sapiens GN=USP43 PE=1 SV=2 521 801 2.0E-20
sp|Q8BUM9|UBP43_MOUSE Ubiquitin carboxyl-terminal hydrolase 43 OS=Mus musculus GN=Usp43 PE=1 SV=2 521 824 2.0E-19
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 1203 1350 3.0E-19
sp|A6ZY34|UBP4_YEAS7 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DOA4 PE=3 SV=1 1173 1350 4.0E-19
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 1202 1349 4.0E-19
sp|Q6PAW2|UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis GN=usp16 PE=2 SV=1 527 711 4.0E-19
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 1202 1349 5.0E-19
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 1202 1349 5.0E-19
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 1202 1349 6.0E-19
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 1203 1348 8.0E-19
sp|B3LGK1|UBP4_YEAS1 Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=DOA4 PE=3 SV=1 1173 1350 9.0E-19
sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2 527 733 9.0E-19
sp|P32571|UBP4_YEAST Ubiquitin carboxyl-terminal hydrolase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOA4 PE=1 SV=2 1173 1350 1.0E-18
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 515 714 2.0E-18
sp|P40453|UBP7_YEAST Ubiquitin carboxyl-terminal hydrolase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP7 PE=1 SV=1 527 716 1.0E-17
sp|Q67XW5|UBP18_ARATH Ubiquitin carboxyl-terminal hydrolase 18 OS=Arabidopsis thaliana GN=UBP18 PE=2 SV=2 1145 1350 1.0E-17
sp|Q754R5|UBP4_ASHGO Ubiquitin carboxyl-terminal hydrolase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DOA4 PE=3 SV=2 1203 1350 2.0E-17
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 1204 1350 2.0E-17
sp|Q9SJA1|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19 OS=Arabidopsis thaliana GN=UBP19 PE=2 SV=2 1198 1433 2.0E-17
sp|Q0VA64|UBP16_XENTR Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus tropicalis GN=usp16 PE=2 SV=2 527 711 2.0E-16
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 1159 1350 2.0E-16
sp|Q9SB51|UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana GN=UBP16 PE=1 SV=1 1203 1362 2.0E-16
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 1179 1350 4.0E-16
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 1159 1350 4.0E-16
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 1199 1351 7.0E-16
sp|P39944|UBP5_YEAST Ubiquitin carboxyl-terminal hydrolase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP5 PE=1 SV=1 1207 1350 9.0E-16
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 1198 1355 1.0E-15
sp|Q9FKP5|UBP17_ARATH Ubiquitin carboxyl-terminal hydrolase 17 OS=Arabidopsis thaliana GN=UBP17 PE=2 SV=1 1203 1356 1.0E-15
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 1198 1351 1.0E-15
sp|A8HAL1|UBP16_DANRE Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio GN=usp16 PE=3 SV=1 527 715 2.0E-15
sp|Q70EL3|UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens GN=USP50 PE=2 SV=1 524 714 5.0E-15
sp|Q9FPS4|UBP23_ARATH Ubiquitin carboxyl-terminal hydrolase 23 OS=Arabidopsis thaliana GN=UBP23 PE=2 SV=2 1203 1350 7.0E-15
sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana GN=UBP2 PE=1 SV=2 523 709 7.0E-15
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2 1203 1358 9.0E-15
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 1198 1351 1.0E-14
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 521 650 2.0E-14
sp|A8HAL1|UBP16_DANRE Ubiquitin carboxyl-terminal hydrolase 16 OS=Danio rerio GN=usp16 PE=3 SV=1 1199 1352 2.0E-14
sp|E1B9W9|UBP42_BOVIN Ubiquitin carboxyl-terminal hydrolase 42 OS=Bos taurus GN=USP42 PE=3 SV=1 1199 1358 2.0E-14
sp|D3ZU96|UBP42_RAT Ubiquitin carboxyl-terminal hydrolase 42 OS=Rattus norvegicus GN=Usp42 PE=1 SV=1 1199 1358 2.0E-14
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 1198 1351 3.0E-14
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 462 726 3.0E-14
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 462 726 3.0E-14
sp|Q9H9J4|UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens GN=USP42 PE=1 SV=3 1199 1358 3.0E-14
sp|Q9FIQ1|UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana GN=UBP21 PE=2 SV=1 1203 1362 4.0E-14
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 525 714 5.0E-14
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 527 711 5.0E-14
sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus GN=USP16 PE=2 SV=2 513 711 5.0E-14
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 525 714 6.0E-14
sp|B2RQC2|UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus GN=Usp42 PE=1 SV=1 1199 1358 6.0E-14
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 1203 1351 6.0E-14
sp|P36026|UBP11_YEAST Ubiquitin carboxyl-terminal hydrolase 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP11 PE=3 SV=1 527 718 7.0E-14
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 1203 1351 7.0E-14
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 1203 1351 8.0E-14
sp|Q9UMW8|UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens GN=USP18 PE=1 SV=1 1203 1350 9.0E-14
sp|O60139|UBP4_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp4 PE=1 SV=2 1202 1352 1.0E-13
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 526 724 1.0E-13
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 524 726 1.0E-13
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 524 726 1.0E-13
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 1204 1352 1.0E-13
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 524 726 1.0E-13
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 1203 1351 1.0E-13
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 526 724 2.0E-13
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 1203 1351 2.0E-13
sp|Q9WTV6|UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus GN=Usp18 PE=1 SV=2 1203 1350 2.0E-13
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp16 PE=1 SV=1 1200 1352 2.0E-13
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 527 711 2.0E-13
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 1194 1350 2.0E-13
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 1194 1350 2.0E-13
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 527 711 3.0E-13
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 1204 1363 3.0E-13
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 1179 1356 4.0E-13
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus GN=Usp45 PE=1 SV=1 1202 1350 4.0E-13
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 1177 1350 5.0E-13
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 521 633 7.0E-13
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 524 713 8.0E-13
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 1179 1356 8.0E-13
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 1109 1355 8.0E-13
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 524 633 9.0E-13
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 524 633 1.0E-12
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 524 726 1.0E-12
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 1202 1350 1.0E-12
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 527 711 1.0E-12
sp|Q9FPS7|UBP20_ARATH Ubiquitin carboxyl-terminal hydrolase 20 OS=Arabidopsis thaliana GN=UBP20 PE=2 SV=1 1203 1350 1.0E-12
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 1139 1285 2.0E-12
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 524 643 2.0E-12
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 521 633 2.0E-12
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 524 717 2.0E-12
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 OS=Mus musculus GN=Usp45 PE=1 SV=1 512 721 2.0E-12
sp|Q8LAM0|UBP4_ARATH Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana GN=UBP4 PE=1 SV=2 1109 1348 2.0E-12
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 524 643 3.0E-12
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 524 643 3.0E-12
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 524 643 3.0E-12
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 524 633 3.0E-12
sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus GN=USP16 PE=2 SV=2 1194 1350 3.0E-12
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 524 717 5.0E-12
sp|Q3LFD5|UBP41_HUMAN Putative ubiquitin carboxyl-terminal hydrolase 41 OS=Homo sapiens GN=USP41 PE=2 SV=2 1203 1333 6.0E-12
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 1208 1351 6.0E-12
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 1208 1351 8.0E-12
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 1208 1351 9.0E-12
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 1204 1352 1.0E-11
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 505 711 2.0E-11
sp|Q9FPS2|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25 OS=Arabidopsis thaliana GN=UBP25 PE=2 SV=1 1203 1355 2.0E-11
sp|C9J2P7|U17LF_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 15 OS=Homo sapiens GN=USP17L15 PE=3 SV=1 1203 1352 2.0E-11
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens GN=USP45 PE=1 SV=3 527 728 2.0E-11
sp|Q70EL3|UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens GN=USP50 PE=2 SV=1 1203 1317 3.0E-11
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 524 633 4.0E-11
sp|D6RA61|U17LM_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 22 OS=Homo sapiens GN=USP17L22 PE=3 SV=1 527 713 4.0E-11
sp|D6RBQ6|U17LH_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 17 OS=Homo sapiens GN=USP17L17 PE=3 SV=1 527 713 4.0E-11
sp|D6R9N7|U17LI_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 18 OS=Homo sapiens GN=USP17L18 PE=3 SV=1 527 713 4.0E-11
sp|C9JVI0|U17LB_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 11 OS=Homo sapiens GN=USP17L11 PE=3 SV=1 527 713 4.0E-11
sp|A8MUK1|U17L5_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 5 OS=Homo sapiens GN=USP17L5 PE=3 SV=2 527 713 4.0E-11
sp|D6RCP7|U17LJ_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 19 OS=Homo sapiens GN=USP17L19 PE=3 SV=1 527 713 4.0E-11
sp|C9JLJ4|U17LD_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 13 OS=Homo sapiens GN=USP17L13 PE=3 SV=1 527 713 4.0E-11
sp|D6RJB6|U17LK_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 20 OS=Homo sapiens GN=USP17L20 PE=3 SV=1 527 713 4.0E-11
sp|Q0WX57|U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens GN=USP17L24 PE=1 SV=2 527 713 4.0E-11
sp|Q6QN14|U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens GN=USP17L6P PE=1 SV=2 527 713 4.0E-11
sp|B1WBD7|UBP20_XENLA Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus laevis GN=usp20 PE=2 SV=1 524 633 5.0E-11
sp|C9J2P7|U17LF_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 15 OS=Homo sapiens GN=USP17L15 PE=3 SV=1 527 713 5.0E-11
sp|D6R901|U17LL_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 21 OS=Homo sapiens GN=USP17L21 PE=3 SV=1 527 713 5.0E-11
sp|C9JPN9|UL17C_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 12 OS=Homo sapiens GN=USP17L12 PE=3 SV=1 527 713 5.0E-11
sp|B4IXE0|UBP36_DROGR Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila grimshawi GN=Usp36 PE=3 SV=1 526 711 6.0E-11
sp|Q9LEW0|UBP22_ARATH Ubiquitin carboxyl-terminal hydrolase 22 OS=Arabidopsis thaliana GN=UBP22 PE=2 SV=1 1203 1348 7.0E-11
sp|D6RA61|U17LM_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 22 OS=Homo sapiens GN=USP17L22 PE=3 SV=1 1203 1352 8.0E-11
sp|A5PN09|UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio GN=usp20 PE=3 SV=1 524 633 9.0E-11
sp|D6RBQ6|U17LH_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 17 OS=Homo sapiens GN=USP17L17 PE=3 SV=1 1203 1352 9.0E-11
sp|C9JLJ4|U17LD_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 13 OS=Homo sapiens GN=USP17L13 PE=3 SV=1 1203 1352 9.0E-11
sp|Q6QN14|U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens GN=USP17L6P PE=1 SV=2 1203 1352 9.0E-11
sp|C9JVI0|U17LB_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 11 OS=Homo sapiens GN=USP17L11 PE=3 SV=1 1203 1352 1.0E-10
sp|D6RCP7|U17LJ_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 19 OS=Homo sapiens GN=USP17L19 PE=3 SV=1 1203 1352 1.0E-10
sp|P53874|UBP10_YEAST Ubiquitin carboxyl-terminal hydrolase 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP10 PE=1 SV=2 1202 1350 1.0E-10
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 1203 1353 1.0E-10
sp|Q5RE63|UBP18_PONAB Ubl carboxyl-terminal hydrolase 18 OS=Pongo abelii GN=USP18 PE=2 SV=1 1205 1350 1.0E-10
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 1139 1285 2.0E-10
sp|Q0VA64|UBP16_XENTR Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus tropicalis GN=usp16 PE=2 SV=2 1200 1350 2.0E-10
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens GN=USP45 PE=1 SV=3 1203 1350 2.0E-10
sp|D6R9N7|U17LI_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 18 OS=Homo sapiens GN=USP17L18 PE=3 SV=1 1203 1352 2.0E-10
sp|A8MUK1|U17L5_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 5 OS=Homo sapiens GN=USP17L5 PE=3 SV=2 1203 1352 2.0E-10
sp|D6RJB6|U17LK_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 20 OS=Homo sapiens GN=USP17L20 PE=3 SV=1 1203 1352 2.0E-10
sp|Q0WX57|U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens GN=USP17L24 PE=1 SV=2 1203 1352 2.0E-10
sp|D6R901|U17LL_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 21 OS=Homo sapiens GN=USP17L21 PE=3 SV=1 1203 1352 2.0E-10
sp|C9JPN9|UL17C_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 12 OS=Homo sapiens GN=USP17L12 PE=3 SV=1 1203 1352 2.0E-10
sp|C9JJH3|U17LA_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 10 OS=Homo sapiens GN=USP17L10 PE=3 SV=1 1203 1352 2.0E-10
sp|B4LG38|UBP36_DROVI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila virilis GN=Usp36 PE=3 SV=1 527 711 2.0E-10
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens GN=USP17L2 PE=1 SV=2 1203 1352 2.0E-10
sp|P0C7I0|U17L8_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8 OS=Homo sapiens GN=USP17L8 PE=3 SV=1 527 713 3.0E-10
sp|Q7M764|U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus GN=Usp17le PE=3 SV=2 1203 1353 5.0E-10
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 3 OS=Homo sapiens GN=USP17L3 PE=3 SV=1 1203 1352 5.0E-10
sp|B4KXJ5|UBP36_DROMO Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila mojavensis GN=Usp36 PE=3 SV=1 525 711 6.0E-10
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens GN=USP17L2 PE=1 SV=2 527 713 7.0E-10
sp|B1AY13|UBP24_MOUSE Ubiquitin carboxyl-terminal hydrolase 24 OS=Mus musculus GN=Usp24 PE=1 SV=1 1203 1329 7.0E-10
sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens GN=USP24 PE=1 SV=3 1203 1329 7.0E-10
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 525 709 9.0E-10
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 3 OS=Homo sapiens GN=USP17L3 PE=3 SV=1 527 713 1.0E-09
sp|Q5RBQ4|UBP46_PONAB Ubiquitin carboxyl-terminal hydrolase 46 OS=Pongo abelii GN=USP46 PE=2 SV=1 1199 1351 1.0E-09
sp|P62069|UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus GN=Usp46 PE=1 SV=1 1199 1351 1.0E-09
sp|P62068|UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens GN=USP46 PE=1 SV=1 1199 1351 1.0E-09
sp|E7F6T8|UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio GN=usp37 PE=2 SV=1 527 712 1.0E-09
sp|Q3TIX9|SNUT2_MOUSE U4/U6.U5 tri-snRNP-associated protein 2 OS=Mus musculus GN=Usp39 PE=1 SV=2 1236 1353 2.0E-09
sp|Q7RTZ2|U17L1_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 1 OS=Homo sapiens GN=USP17L1 PE=3 SV=1 527 713 2.0E-09
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 OS=Homo sapiens GN=USP17L4 PE=3 SV=3 527 713 2.0E-09
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 1283 1370 3.0E-09
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 OS=Homo sapiens GN=USP17L4 PE=3 SV=3 1203 1352 3.0E-09
sp|Q5R761|SNUT2_PONAB U4/U6.U5 tri-snRNP-associated protein 2 OS=Pongo abelii GN=USP39 PE=2 SV=1 1236 1353 3.0E-09
sp|Q53GS9|SNUT2_HUMAN U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens GN=USP39 PE=1 SV=2 1236 1353 3.0E-09
sp|O96612|UBPB_DICDI Ubiquitin hydrolase B OS=Dictyostelium discoideum GN=ubpB PE=1 SV=1 1159 1349 3.0E-09
sp|A5D9H7|UBP12_BOVIN Ubiquitin carboxyl-terminal hydrolase 12 OS=Bos taurus GN=USP12 PE=2 SV=1 1199 1351 3.0E-09
sp|B4PIW8|UBP36_DROYA Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila yakuba GN=Usp36 PE=3 SV=1 525 709 3.0E-09
sp|Q52KZ6|UB12A_XENLA Ubiquitin carboxyl-terminal hydrolase 12-A OS=Xenopus laevis GN=usp12-a PE=2 SV=1 1199 1351 4.0E-09
sp|B3NC86|UBP36_DROER Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila erecta GN=Usp36 PE=3 SV=1 525 709 4.0E-09
sp|C0HB46|UBP12_SALSA Ubiquitin carboxyl-terminal hydrolase 12 OS=Salmo salar GN=usp12 PE=2 SV=1 1199 1351 4.0E-09
sp|O75317|UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens GN=USP12 PE=1 SV=2 1199 1351 4.0E-09
sp|Q5M981|UB12B_XENLA Ubiquitin carboxyl-terminal hydrolase 12-B OS=Xenopus laevis GN=usp12-b PE=2 SV=2 1199 1351 4.0E-09
sp|A4FUN7|UBP12_DANRE Ubiquitin carboxyl-terminal hydrolase 12A OS=Danio rerio GN=usp12a PE=2 SV=1 1199 1351 4.0E-09
sp|A5WWB0|UBP46_DANRE Ubiquitin carboxyl-terminal hydrolase 46 OS=Danio rerio GN=usp46 PE=3 SV=2 1199 1351 4.0E-09
sp|Q9D9M2|UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus GN=Usp12 PE=2 SV=2 1199 1351 4.0E-09
sp|B4MLR8|UBP36_DROWI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila willistoni GN=Usp36 PE=3 SV=1 1203 1359 7.0E-09
sp|Q5ZM45|UBP48_CHICK Ubiquitin carboxyl-terminal hydrolase 48 OS=Gallus gallus GN=USP48 PE=2 SV=1 1198 1332 7.0E-09
sp|Q3V0C5|UBP48_MOUSE Ubiquitin carboxyl-terminal hydrolase 48 OS=Mus musculus GN=Usp48 PE=1 SV=2 1198 1332 7.0E-09
sp|Q8W4N3|UBP2_ARATH Ubiquitin carboxyl-terminal hydrolase 2 OS=Arabidopsis thaliana GN=UBP2 PE=1 SV=2 1232 1350 8.0E-09
sp|Q7RTZ2|U17L1_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 1 OS=Homo sapiens GN=USP17L1 PE=3 SV=1 1203 1352 9.0E-09
sp|Q86UV5|UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens GN=USP48 PE=1 SV=1 1198 1332 1.0E-08
sp|E1BMF7|UBP13_BOVIN Ubiquitin carboxyl-terminal hydrolase 13 OS=Bos taurus GN=USP13 PE=3 SV=2 524 632 1.0E-08
sp|Q76LT8|UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus GN=Usp48 PE=1 SV=1 1198 1332 1.0E-08
sp|Q5BKP2|UBP13_MOUSE Ubiquitin carboxyl-terminal hydrolase 13 OS=Mus musculus GN=Usp13 PE=1 SV=1 524 632 1.0E-08
sp|Q92995|UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens GN=USP13 PE=1 SV=2 524 632 1.0E-08
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 1283 1370 2.0E-08
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 525 709 2.0E-08
sp|Q8BW70|UBP38_MOUSE Ubiquitin carboxyl-terminal hydrolase 38 OS=Mus musculus GN=Usp38 PE=1 SV=2 524 709 2.0E-08
sp|B4QIS3|UBP36_DROSI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila simulans GN=Usp36 PE=3 SV=1 525 709 3.0E-08
sp|B4HUI5|UBP36_DROSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila sechellia GN=Usp36 PE=3 SV=1 525 709 3.0E-08
sp|Q8NB14|UBP38_HUMAN Ubiquitin carboxyl-terminal hydrolase 38 OS=Homo sapiens GN=USP38 PE=1 SV=2 524 722 3.0E-08
sp|P38187|UBP13_YEAST Ubiquitin carboxyl-terminal hydrolase 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP13 PE=1 SV=3 1200 1349 3.0E-08
sp|A1CW53|CREB_NEOFI Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creB PE=3 SV=2 1207 1349 4.0E-08
sp|B8NSV5|CREB_ASPFN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creB PE=3 SV=1 1207 1349 5.0E-08
sp|Q2UUG8|CREB_ASPOR Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creB PE=3 SV=2 1207 1349 5.0E-08
sp|Q9VRP5|UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster GN=scny PE=1 SV=3 525 709 5.0E-08
sp|P34547|UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans GN=usp-46 PE=1 SV=3 1199 1351 5.0E-08
sp|Q86T82|UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens GN=USP37 PE=1 SV=2 527 712 5.0E-08
sp|B0Y4P5|CREB_ASPFC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creB PE=3 SV=1 1207 1349 5.0E-08
sp|Q4WQI1|CREB_ASPFU Probable ubiquitin carboxyl-terminal hydrolase creB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creB PE=3 SV=3 1207 1349 6.0E-08
sp|Q70CQ2|UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens GN=USP34 PE=1 SV=2 1159 1350 6.0E-08
sp|Q0CT11|CREB_ASPTN Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=creB PE=3 SV=2 1207 1349 6.0E-08
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 594 712 7.0E-08
sp|P0C7H9|U17L7_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 7 OS=Homo sapiens GN=USP17L7 PE=3 SV=1 1203 1352 7.0E-08
sp|Q8C0R0|UBP37_MOUSE Ubiquitin carboxyl-terminal hydrolase 37 OS=Mus musculus GN=Usp37 PE=1 SV=1 527 712 7.0E-08
sp|B3M3M6|UBP36_DROAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila ananassae GN=Usp36 PE=3 SV=1 527 709 7.0E-08
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 527 749 8.0E-08
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 1203 1348 9.0E-08
sp|A1CIL1|CREB_ASPCL Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creB PE=3 SV=2 1207 1349 9.0E-08
sp|A2Q9N1|CREB_ASPNC Probable ubiquitin carboxyl-terminal hydrolase creB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creB PE=3 SV=2 1207 1349 9.0E-08
sp|Q9FPT5|UBP1_ARATH Ubiquitin carboxyl-terminal hydrolase 1 OS=Arabidopsis thaliana GN=UBP1 PE=1 SV=2 1232 1350 1.0E-07
sp|B4IXE0|UBP36_DROGR Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila grimshawi GN=Usp36 PE=3 SV=1 1203 1354 1.0E-07
sp|B4KXJ5|UBP36_DROMO Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila mojavensis GN=Usp36 PE=3 SV=1 1203 1348 1.0E-07
sp|Q96V54|CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creB PE=1 SV=1 1207 1349 1.0E-07
sp|F1SRY5|UBP37_PIG Ubiquitin carboxyl-terminal hydrolase 37 OS=Sus scrofa GN=USP37 PE=3 SV=1 527 712 1.0E-07
sp|A2XDG4|UBP26_ORYSI Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza sativa subsp. indica GN=UBP26 PE=3 SV=1 1204 1329 2.0E-07
sp|A3AF13|UBP26_ORYSJ Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza sativa subsp. japonica GN=UBP26 PE=3 SV=2 1204 1329 2.0E-07
sp|Q9SCJ9|UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 26 OS=Arabidopsis thaliana GN=UBP26 PE=1 SV=3 1203 1424 2.0E-07
sp|P52479|UBP10_MOUSE Ubiquitin carboxyl-terminal hydrolase 10 OS=Mus musculus GN=Usp10 PE=1 SV=3 1216 1350 3.0E-07
sp|Q92353|UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp6 PE=1 SV=2 527 634 3.0E-07
sp|E2RK09|UBP37_CANLF Ubiquitin carboxyl-terminal hydrolase 37 OS=Canis lupus familiaris GN=USP37 PE=3 SV=1 527 712 3.0E-07
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 1159 1351 3.0E-07
sp|F1N5V1|UBP37_BOVIN Ubiquitin carboxyl-terminal hydrolase 37 OS=Bos taurus GN=USP37 PE=3 SV=1 527 712 4.0E-07
sp|Q6ZQ93|UBP34_MOUSE Ubiquitin carboxyl-terminal hydrolase 34 OS=Mus musculus GN=Usp34 PE=1 SV=3 1159 1350 5.0E-07
sp|Q8LAM0|UBP4_ARATH Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana GN=UBP4 PE=1 SV=2 527 749 6.0E-07
sp|Q3KR59|UBP10_RAT Ubiquitin carboxyl-terminal hydrolase 10 OS=Rattus norvegicus GN=Usp10 PE=1 SV=1 1216 1350 6.0E-07
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 519 711 7.0E-07
sp|A4FUN7|UBP12_DANRE Ubiquitin carboxyl-terminal hydrolase 12A OS=Danio rerio GN=usp12a PE=2 SV=1 527 709 8.0E-07
sp|Q9FPS3|UBP24_ARATH Ubiquitin carboxyl-terminal hydrolase 24 OS=Arabidopsis thaliana GN=UBP24 PE=1 SV=1 1234 1350 9.0E-07
sp|E1BY77|UBP13_CHICK Ubiquitin carboxyl-terminal hydrolase 13 OS=Gallus gallus GN=USP13 PE=3 SV=1 524 632 9.0E-07
sp|E1C213|UBP37_CHICK Ubiquitin carboxyl-terminal hydrolase 37 OS=Gallus gallus GN=USP37 PE=3 SV=1 527 735 9.0E-07
sp|Q949Y0|UBP6_ARATH Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana GN=UBP6 PE=1 SV=1 525 633 1.0E-06
sp|Q9P7V9|UBP9_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp9 PE=1 SV=1 1203 1348 2.0E-06
sp|Q9P2H5|UBP35_HUMAN Ubiquitin carboxyl-terminal hydrolase 35 OS=Homo sapiens GN=USP35 PE=1 SV=3 517 632 2.0E-06
sp|C0HB46|UBP12_SALSA Ubiquitin carboxyl-terminal hydrolase 12 OS=Salmo salar GN=usp12 PE=2 SV=1 527 757 3.0E-06
sp|P55824|FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster GN=faf PE=1 SV=2 1203 1329 4.0E-06
sp|B4MLR8|UBP36_DROWI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila willistoni GN=Usp36 PE=3 SV=1 525 709 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0006508 proteolysis No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup258
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6289
Ophiocordyceps australis 1348a (Ghana) OphauG2|6290
Ophiocordyceps australis map64 (Brazil) OphauB2|4366
Ophiocordyceps australis map64 (Brazil) OphauB2|4367
Ophiocordyceps camponoti-floridani Ophcf2|05034
Ophiocordyceps camponoti-rufipedis Ophun1|4211 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4212
Ophiocordyceps kimflemingae Ophio5|2102
Ophiocordyceps kimflemingae Ophio5|2103
Ophiocordyceps subramaniannii Hirsu2|1017
Ophiocordyceps subramaniannii Hirsu2|1018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4211
MGTDTVHARSLSPDTALPSCEADDDPAFSVASGLNTPLYARADSLPASSLPPRLQTQATSLVSAEYASSVASSSP
CASICADLSLESDRGGEEAGSALSLTRSQSPLRWSRRVIMNGDDELPRRSSSPLKRRASGMEDSASDAGNRNSAA
DGDVNSSGRHNRAMSIDAPETNGQGNTQGLSHPSPPLQEQIKIIETLLKASNDSPLIKDNAAYLVSRSWLNQALA
LRSDSKSSGGSGPADASLGPVDNSDIIGETIVDSNGKTFVRLKPGLGLESFELFSADAWKLVMDWYGLRQGQHPI
IRFAVNTADTHDDPPNIMYEFHPPVFRIHRIWSEVSPLPIEQSLKERNPPPLIVATSSTIISQSFLGNLKTLTGI
PMNRKVRLWSVSVTVAGGQAEPQATLTPPDSPTSQSGQSWQNLLVDLPSFSRADKAQIHMADHTADDKFNGRAPL
KCFLNPSVDTLVIDEAVSGSWVSTFTPDKAEKSIPTRVNMAVVSSKLNSSRNSPTEGMLTRGRAQKKRMGRMDGA
VGLHNLGNTCYMNSALQCVRSVEELSKYFLTESHLPEINEANVLGFQGKLAMAYGNLLREIYEEGRNAVSPRDFK
ATVGRCRPTFSGWGQQDSQEFLGFLLDALQEDLSRVKKKPYIAKPDSTDDMINNPEAIRRMAAEVWDITRRRDDS
VIADLFTGMYKSTLKCPECGKISITFDPFYNLTLPLPAESMWTRPVKFYPLHDAPVMLDVELPQHSSMESLKRFV
SARTGVPANRMMGAEEFRDRFFKIYNDTHDVSEEVSAQDIPTLHEVEAPPTNWPGKAPRKKFRSMLDVDMPLHAG
EFEEEMSQVMAVPVFYRRARCPGGRLDGCVPAHFITLTRKEACSMDAIQRKILVKLATFSTWSKLTDDNGTSDSG
DLLTTTSSDVDSSGDSKIAARSVEGEDDMVDISMRDSHAKASGQITPLKTFSRRRPRFADPDVFLDPELQNLFEL
SYFRQDSDGPIPTAWSTFDNETVLDKMSDRVPADRASIGSPDSTISGNEDSSNADEAAAEASVTRMTEESSDEDA
CPAARVRTPIRSLTADFHMLTFYQFTNRPSRHAVKGGAGNRKKFKKHQTYGKKGNKRRDKQMRAPKSAQRAQVAV
SPQPVPRALPDGGPLIRLYEGIVVDWSEETWDVVFGGTSKRHDALRGSKTYMDIETLHDPALKMNQRRRQTRHKE
GITLEQCLDEFERAEVLSEQDMWFCPRCKEHRRASKKFDLWKTPDILVAHLKRFSNSAWRREKIDVLVDFPIEGL
DLTSRVIEKEDGKVEIYDLIAIDDHYGGLGGGHYTAYAKNFVDGRWYNFNDSSVHAVSDPQSMVTSAAYLLFYRR
RSNGPLGGPRFAEISAKYDGDVGTSDGENVESGSDGRGGRLAIKAEDEETLPPYSATIRRSIEGDEDQGAGGYIG
PEGKSLDMTQGWTFEALEERGAARSTGGECGSDDVQFDSSDEAYRGGDCFEQDTDMASSAAVDDGTAWTGQGVLA
VPAQAGSEGDSDEVAEIHIDGDRTGRP*
Coding >Ophun1|4211
ATGGGCACGGACACTGTGCATGCACGCTCCCTGTCTCCAGATACGGCGCTGCCGTCGTGCGAGGCCGACGACGAT
CCCGCCTTTTCCGTAGCCTCCGGGCTCAACACGCCGCTCTACGCACGCGCCGACTCGCTGCCGGCCTCTAGTCTG
CCCCCGCGGCTGCAGACGCAGGCGACGTCTCTCGTCTCGGCCGAGTACGCGTCTTCGGTCGCTTCGTCATCTCCC
TGTGCCTCCATCTGCGCCGATCTTTCCCTCGAGAGCGACAGAGGGGGGGAAGAGGCCGGCTCGGCCCTCAGCTTG
ACCAGGAGCCAGTCGCCTTTGAGGTGGTCTCGTCGGGTTATCATGAATGGTGATGACGAACTGCCTCGTCGCTCG
TCATCTCCCCTCAAGCGACGCGCATCCGGCATGGAAGACTCCGCGTCCGACGCAGGCAACAGGAACTCTGCCGCC
GATGGTGACGTCAACTCGTCAGGCCGTCACAATCGCGCCATGAGCATCGACGCGCCCGAGACGAACGGCCAAGGG
AATACCCAAGGTCTCTCTCATCCATCGCCTCCACTGCAGGAGCAAATAAAGATAATCGAGACGCTGCTCAAGGCC
TCCAACGACTCGCCTCTGATCAAGGACAATGCCGCCTATCTGGTCTCACGCTCGTGGCTGAACCAGGCGCTCGCT
CTACGGTCAGATTCCAAGTCGTCCGGCGGCTCCGGCCCGGCCGACGCCTCGTTGGGCCCCGTCGACAACTCCGAC
ATTATCGGGGAGACCATCGTCGATTCAAACGGAAAAACCTTTGTTCGCCTCAAGCCCGGCCTCGGTCTTGAATCT
TTCGAGCTCTTCTCCGCCGATGCGTGGAAGCTGGTAATGGACTGGTACGGATTACGGCAAGGCCAGCACCCCATC
ATTCGCTTTGCCGTCAATACAGCCGATACCCATGACGATCCGCCCAATATCATGTACGAGTTCCACCCGCCCGTC
TTCCGCATCCATCGCATATGGTCCGAAGTCAGCCCCTTGCCGATAGAGCAGTCTCTCAAGGAACGGAATCCGCCG
CCCCTGATTGTGGCGACCAGCTCGACCATCATCTCTCAGTCGTTTCTCGGGAATCTAAAGACGCTCACCGGCATC
CCCATGAACCGCAAAGTCCGCCTGTGGTCGGTCTCCGTTACCGTCGCTGGCGGACAAGCGGAGCCGCAGGCGACT
CTGACGCCCCCAGACTCGCCGACGTCCCAGTCTGGACAGTCGTGGCAGAACCTGCTGGTCGACCTCCCCAGCTTC
TCCCGGGCCGACAAGGCGCAGATACACATGGCGGACCATACGGCGGACGATAAGTTCAATGGCAGAGCTCCTCTC
AAATGCTTCCTCAACCCAAGCGTCGACACGCTCGTCATCGACGAAGCCGTCAGCGGCAGCTGGGTCAGCACCTTT
ACGCCAGACAAGGCAGAGAAATCCATCCCCACCCGGGTCAACATGGCGGTCGTATCTTCCAAGCTCAACAGTAGC
CGGAACAGCCCCACTGAAGGCATGCTCACCCGCGGCCGGGCTCAAAAGAAGCGGATGGGCCGGATGGATGGGGCC
GTGGGCCTGCACAATCTGGGAAACACGTGCTACATGAACTCGGCCCTGCAGTGCGTCCGCAGCGTTGAGGAGCTG
TCCAAGTACTTCTTGACGGAGTCGCATCTGCCCGAGATCAACGAAGCAAACGTACTCGGCTTTCAGGGCAAATTG
GCCATGGCTTACGGGAATCTTCTCAGGGAGATTTATGAGGAAGGGAGAAATGCGGTCAGCCCGCGCGATTTCAAA
GCAACGGTCGGGCGCTGCCGTCCCACGTTTTCTGGATGGGGACAGCAGGACTCGCAGGAGTTTCTAGGTTTCCTC
CTCGACGCTCTGCAGGAGGACTTGAGCCGCGTGAAGAAGAAGCCATATATTGCCAAGCCCGACTCGACGGACGAC
ATGATCAACAATCCCGAGGCCATCCGGCGTATGGCAGCCGAGGTCTGGGACATCACTCGACGCCGAGACGATTCG
GTCATTGCCGACTTGTTCACGGGCATGTACAAGTCAACGCTCAAGTGCCCAGAGTGCGGCAAGATCAGCATCACG
TTTGACCCCTTTTACAACCTGACGCTGCCGCTGCCCGCGGAGAGCATGTGGACCAGGCCCGTCAAGTTCTATCCG
CTCCACGACGCGCCCGTCATGCTAGACGTGGAGTTGCCCCAGCACAGCTCCATGGAGAGTCTCAAGAGATTCGTC
TCCGCTCGAACTGGCGTTCCCGCCAACCGGATGATGGGGGCCGAGGAGTTCAGAGACCGCTTCTTCAAGATATAC
AACGACACCCATGATGTGTCGGAAGAGGTTTCGGCCCAAGATATACCGACCTTGCATGAGGTAGAGGCGCCCCCG
ACGAACTGGCCAGGCAAGGCCCCGCGCAAGAAGTTCCGGTCCATGCTGGACGTCGACATGCCCCTACACGCCGGC
GAGTTCGAAGAAGAGATGAGCCAGGTCATGGCCGTGCCGGTGTTTTATCGCCGGGCTCGATGCCCCGGCGGTCGG
CTCGACGGGTGCGTGCCAGCTCATTTCATCACGCTGACGAGGAAAGAGGCTTGCAGCATGGATGCGATTCAGCGC
AAGATATTGGTCAAGTTGGCTACCTTTTCCACCTGGTCCAAGCTCACCGATGACAACGGCACGTCGGACTCTGGG
GATCTGCTCACCACGACGTCTTCCGATGTCGATTCTTCCGGTGACAGTAAAATCGCCGCCCGGTCGGTTGAGGGC
GAGGATGACATGGTGGACATCTCCATGAGGGACTCGCATGCCAAGGCCAGCGGCCAGATAACGCCGCTCAAGACC
TTCAGCCGGCGACGGCCCAGGTTCGCTGACCCTGATGTCTTCCTCGACCCGGAACTCCAGAACCTATTTGAGCTA
TCGTACTTTCGTCAAGACTCGGACGGTCCTATCCCGACCGCCTGGTCGACCTTTGATAACGAGACGGTCCTGGAC
AAGATGTCGGACCGCGTCCCGGCTGATAGGGCCAGCATCGGGAGTCCAGACAGCACCATCTCGGGCAACGAGGAC
AGCAGCAACGCGGACGAGGCGGCAGCGGAGGCGTCGGTGACGCGCATGACGGAGGAGTCGAGCGACGAGGACGCG
TGTCCAGCGGCGAGGGTTCGCACGCCCATCAGGAGCCTGACGGCCGATTTCCATATGCTGACATTTTACCAGTTC
ACGAACCGCCCCAGCCGGCATGCCGTGAAGGGTGGTGCTGGCAATCGCAAGAAGTTTAAGAAACACCAGACCTAC
GGCAAGAAGGGCAACAAGCGCCGCGATAAACAGATGCGCGCGCCCAAGTCCGCGCAGCGTGCGCAGGTGGCTGTC
AGTCCCCAGCCCGTGCCGCGGGCCCTGCCCGACGGAGGTCCCCTTATCCGCCTGTACGAGGGCATCGTCGTCGAC
TGGAGCGAGGAGACCTGGGACGTCGTCTTTGGCGGCACCTCGAAACGCCACGATGCCTTGCGTGGTTCCAAGACT
TACATGGACATTGAGACGTTGCACGATCCCGCCCTCAAGATGAACCAGCGAAGGCGTCAGACGCGCCACAAGGAA
GGCATCACGCTGGAGCAGTGTCTGGACGAGTTTGAGCGCGCCGAAGTCCTTTCGGAGCAGGACATGTGGTTCTGT
CCTCGCTGCAAGGAGCACCGGCGAGCGAGCAAGAAGTTTGACCTGTGGAAGACGCCCGACATACTGGTCGCTCAC
CTCAAGCGGTTCAGCAACTCGGCCTGGCGGCGGGAGAAGATAGACGTCCTCGTCGACTTTCCCATAGAAGGACTC
GACCTCACGTCGCGAGTGATTGAGAAGGAAGACGGTAAGGTGGAGATTTACGACCTGATCGCCATCGACGACCAC
TATGGCGGTCTGGGCGGAGGCCATTACACCGCGTACGCCAAGAACTTTGTCGACGGACGCTGGTACAACTTTAAC
GACTCTTCGGTCCACGCCGTGTCGGACCCGCAGTCGATGGTGACCAGCGCCGCATACCTGCTCTTCTACCGACGA
CGTTCCAACGGACCGCTCGGCGGACCGCGGTTTGCCGAGATCTCGGCCAAGTACGACGGAGACGTCGGCACGTCT
GACGGGGAAAACGTCGAGTCGGGTTCGGACGGTCGGGGAGGCCGGCTGGCTATCAAGGCTGAGGACGAAGAGACG
CTGCCGCCGTACTCGGCGACGATCCGTCGGAGCATCGAAGGCGACGAGGATCAAGGAGCTGGCGGCTACATTGGG
CCGGAAGGAAAGTCACTGGATATGACACAGGGCTGGACCTTTGAAGCTCTCGAGGAACGCGGAGCTGCAAGGTCG
ACTGGCGGCGAGTGCGGTAGCGACGACGTGCAGTTCGACTCGAGCGACGAAGCCTACCGCGGAGGCGACTGCTTT
GAGCAGGACACGGACATGGCGTCGAGCGCGGCCGTCGATGACGGTACGGCTTGGACTGGCCAGGGGGTGCTCGCG
GTGCCTGCGCAAGCCGGCAGCGAGGGTGATTCAGACGAGGTGGCCGAGATTCACATCGACGGCGACAGGACAGGG
CGTCCATGA
Transcript >Ophun1|4211
ATGGGCACGGACACTGTGCATGCACGCTCCCTGTCTCCAGATACGGCGCTGCCGTCGTGCGAGGCCGACGACGAT
CCCGCCTTTTCCGTAGCCTCCGGGCTCAACACGCCGCTCTACGCACGCGCCGACTCGCTGCCGGCCTCTAGTCTG
CCCCCGCGGCTGCAGACGCAGGCGACGTCTCTCGTCTCGGCCGAGTACGCGTCTTCGGTCGCTTCGTCATCTCCC
TGTGCCTCCATCTGCGCCGATCTTTCCCTCGAGAGCGACAGAGGGGGGGAAGAGGCCGGCTCGGCCCTCAGCTTG
ACCAGGAGCCAGTCGCCTTTGAGGTGGTCTCGTCGGGTTATCATGAATGGTGATGACGAACTGCCTCGTCGCTCG
TCATCTCCCCTCAAGCGACGCGCATCCGGCATGGAAGACTCCGCGTCCGACGCAGGCAACAGGAACTCTGCCGCC
GATGGTGACGTCAACTCGTCAGGCCGTCACAATCGCGCCATGAGCATCGACGCGCCCGAGACGAACGGCCAAGGG
AATACCCAAGGTCTCTCTCATCCATCGCCTCCACTGCAGGAGCAAATAAAGATAATCGAGACGCTGCTCAAGGCC
TCCAACGACTCGCCTCTGATCAAGGACAATGCCGCCTATCTGGTCTCACGCTCGTGGCTGAACCAGGCGCTCGCT
CTACGGTCAGATTCCAAGTCGTCCGGCGGCTCCGGCCCGGCCGACGCCTCGTTGGGCCCCGTCGACAACTCCGAC
ATTATCGGGGAGACCATCGTCGATTCAAACGGAAAAACCTTTGTTCGCCTCAAGCCCGGCCTCGGTCTTGAATCT
TTCGAGCTCTTCTCCGCCGATGCGTGGAAGCTGGTAATGGACTGGTACGGATTACGGCAAGGCCAGCACCCCATC
ATTCGCTTTGCCGTCAATACAGCCGATACCCATGACGATCCGCCCAATATCATGTACGAGTTCCACCCGCCCGTC
TTCCGCATCCATCGCATATGGTCCGAAGTCAGCCCCTTGCCGATAGAGCAGTCTCTCAAGGAACGGAATCCGCCG
CCCCTGATTGTGGCGACCAGCTCGACCATCATCTCTCAGTCGTTTCTCGGGAATCTAAAGACGCTCACCGGCATC
CCCATGAACCGCAAAGTCCGCCTGTGGTCGGTCTCCGTTACCGTCGCTGGCGGACAAGCGGAGCCGCAGGCGACT
CTGACGCCCCCAGACTCGCCGACGTCCCAGTCTGGACAGTCGTGGCAGAACCTGCTGGTCGACCTCCCCAGCTTC
TCCCGGGCCGACAAGGCGCAGATACACATGGCGGACCATACGGCGGACGATAAGTTCAATGGCAGAGCTCCTCTC
AAATGCTTCCTCAACCCAAGCGTCGACACGCTCGTCATCGACGAAGCCGTCAGCGGCAGCTGGGTCAGCACCTTT
ACGCCAGACAAGGCAGAGAAATCCATCCCCACCCGGGTCAACATGGCGGTCGTATCTTCCAAGCTCAACAGTAGC
CGGAACAGCCCCACTGAAGGCATGCTCACCCGCGGCCGGGCTCAAAAGAAGCGGATGGGCCGGATGGATGGGGCC
GTGGGCCTGCACAATCTGGGAAACACGTGCTACATGAACTCGGCCCTGCAGTGCGTCCGCAGCGTTGAGGAGCTG
TCCAAGTACTTCTTGACGGAGTCGCATCTGCCCGAGATCAACGAAGCAAACGTACTCGGCTTTCAGGGCAAATTG
GCCATGGCTTACGGGAATCTTCTCAGGGAGATTTATGAGGAAGGGAGAAATGCGGTCAGCCCGCGCGATTTCAAA
GCAACGGTCGGGCGCTGCCGTCCCACGTTTTCTGGATGGGGACAGCAGGACTCGCAGGAGTTTCTAGGTTTCCTC
CTCGACGCTCTGCAGGAGGACTTGAGCCGCGTGAAGAAGAAGCCATATATTGCCAAGCCCGACTCGACGGACGAC
ATGATCAACAATCCCGAGGCCATCCGGCGTATGGCAGCCGAGGTCTGGGACATCACTCGACGCCGAGACGATTCG
GTCATTGCCGACTTGTTCACGGGCATGTACAAGTCAACGCTCAAGTGCCCAGAGTGCGGCAAGATCAGCATCACG
TTTGACCCCTTTTACAACCTGACGCTGCCGCTGCCCGCGGAGAGCATGTGGACCAGGCCCGTCAAGTTCTATCCG
CTCCACGACGCGCCCGTCATGCTAGACGTGGAGTTGCCCCAGCACAGCTCCATGGAGAGTCTCAAGAGATTCGTC
TCCGCTCGAACTGGCGTTCCCGCCAACCGGATGATGGGGGCCGAGGAGTTCAGAGACCGCTTCTTCAAGATATAC
AACGACACCCATGATGTGTCGGAAGAGGTTTCGGCCCAAGATATACCGACCTTGCATGAGGTAGAGGCGCCCCCG
ACGAACTGGCCAGGCAAGGCCCCGCGCAAGAAGTTCCGGTCCATGCTGGACGTCGACATGCCCCTACACGCCGGC
GAGTTCGAAGAAGAGATGAGCCAGGTCATGGCCGTGCCGGTGTTTTATCGCCGGGCTCGATGCCCCGGCGGTCGG
CTCGACGGGTGCGTGCCAGCTCATTTCATCACGCTGACGAGGAAAGAGGCTTGCAGCATGGATGCGATTCAGCGC
AAGATATTGGTCAAGTTGGCTACCTTTTCCACCTGGTCCAAGCTCACCGATGACAACGGCACGTCGGACTCTGGG
GATCTGCTCACCACGACGTCTTCCGATGTCGATTCTTCCGGTGACAGTAAAATCGCCGCCCGGTCGGTTGAGGGC
GAGGATGACATGGTGGACATCTCCATGAGGGACTCGCATGCCAAGGCCAGCGGCCAGATAACGCCGCTCAAGACC
TTCAGCCGGCGACGGCCCAGGTTCGCTGACCCTGATGTCTTCCTCGACCCGGAACTCCAGAACCTATTTGAGCTA
TCGTACTTTCGTCAAGACTCGGACGGTCCTATCCCGACCGCCTGGTCGACCTTTGATAACGAGACGGTCCTGGAC
AAGATGTCGGACCGCGTCCCGGCTGATAGGGCCAGCATCGGGAGTCCAGACAGCACCATCTCGGGCAACGAGGAC
AGCAGCAACGCGGACGAGGCGGCAGCGGAGGCGTCGGTGACGCGCATGACGGAGGAGTCGAGCGACGAGGACGCG
TGTCCAGCGGCGAGGGTTCGCACGCCCATCAGGAGCCTGACGGCCGATTTCCATATGCTGACATTTTACCAGTTC
ACGAACCGCCCCAGCCGGCATGCCGTGAAGGGTGGTGCTGGCAATCGCAAGAAGTTTAAGAAACACCAGACCTAC
GGCAAGAAGGGCAACAAGCGCCGCGATAAACAGATGCGCGCGCCCAAGTCCGCGCAGCGTGCGCAGGTGGCTGTC
AGTCCCCAGCCCGTGCCGCGGGCCCTGCCCGACGGAGGTCCCCTTATCCGCCTGTACGAGGGCATCGTCGTCGAC
TGGAGCGAGGAGACCTGGGACGTCGTCTTTGGCGGCACCTCGAAACGCCACGATGCCTTGCGTGGTTCCAAGACT
TACATGGACATTGAGACGTTGCACGATCCCGCCCTCAAGATGAACCAGCGAAGGCGTCAGACGCGCCACAAGGAA
GGCATCACGCTGGAGCAGTGTCTGGACGAGTTTGAGCGCGCCGAAGTCCTTTCGGAGCAGGACATGTGGTTCTGT
CCTCGCTGCAAGGAGCACCGGCGAGCGAGCAAGAAGTTTGACCTGTGGAAGACGCCCGACATACTGGTCGCTCAC
CTCAAGCGGTTCAGCAACTCGGCCTGGCGGCGGGAGAAGATAGACGTCCTCGTCGACTTTCCCATAGAAGGACTC
GACCTCACGTCGCGAGTGATTGAGAAGGAAGACGGTAAGGTGGAGATTTACGACCTGATCGCCATCGACGACCAC
TATGGCGGTCTGGGCGGAGGCCATTACACCGCGTACGCCAAGAACTTTGTCGACGGACGCTGGTACAACTTTAAC
GACTCTTCGGTCCACGCCGTGTCGGACCCGCAGTCGATGGTGACCAGCGCCGCATACCTGCTCTTCTACCGACGA
CGTTCCAACGGACCGCTCGGCGGACCGCGGTTTGCCGAGATCTCGGCCAAGTACGACGGAGACGTCGGCACGTCT
GACGGGGAAAACGTCGAGTCGGGTTCGGACGGTCGGGGAGGCCGGCTGGCTATCAAGGCTGAGGACGAAGAGACG
CTGCCGCCGTACTCGGCGACGATCCGTCGGAGCATCGAAGGCGACGAGGATCAAGGAGCTGGCGGCTACATTGGG
CCGGAAGGAAAGTCACTGGATATGACACAGGGCTGGACCTTTGAAGCTCTCGAGGAACGCGGAGCTGCAAGGTCG
ACTGGCGGCGAGTGCGGTAGCGACGACGTGCAGTTCGACTCGAGCGACGAAGCCTACCGCGGAGGCGACTGCTTT
GAGCAGGACACGGACATGGCGTCGAGCGCGGCCGTCGATGACGGTACGGCTTGGACTGGCCAGGGGGTGCTCGCG
GTGCCTGCGCAAGCCGGCAGCGAGGGTGATTCAGACGAGGTGGCCGAGATTCACATCGACGGCGACAGGACAGGG
CGTCCATGA
Gene >Ophun1|4211
ATGGGCACGGACACTGTGCATGCACGGTGAGAAACGGCCAGGTCTTCCACCAGGAAGTACTGGGCGACTCCGCCC
TGCTCCCAGGCTGTGTCAGCCCTCTCCATTGCCCCGAAAGTCCTCTGCCAGGCGAAGCGCTTCCTCGCGAAAAGG
GCAAAAAAATAAAAATAAAAAACACAGGACAGCGTCTTGCCGACTCTCTGCTCTCCAGCCTCGGACGACGCGCTT
CCATCATCGATTCGCGAGCGACAAGTGCCTTCAGGTCCTCATCCGCCCGGCTTCCAGGTCTCGCCTCCCTGCCCT
CCCTGCTTCCCGAGCCTGCCTGCGATCACTGCCGCGCTTTCCAGCGTGTGTGCATGTCTGGCCGTCGCCTCGCGC
AGCCTTCTCTGCTGCCATCGTCCGATGCTGGGCTGTCTTCGCTCCTCGGCTGGCCTCGACATCGCCTACAGAGTT
TTTCACTAAAGGTCGAGACGACAGATTGATGCGACCTCGCCGCCTGGCAGCCATCGTCGTCCCTTCGCCTCTCTC
GCACCCCCGAGCTGCCCGGGCAGCTCACTGTCAAGACGCCTTCCTCAAAGAAGAGAAAGCTCGCCCGCCCTCCCT
CGAACAACTCCAGCTCCCTGTCTCCAGATACGGCGCTGCCGTCGTGCGAGGCCGACGACGATCCCGCCTTTTCCG
TAGCCTCCGGGCTCAACACGCCGCTCTACGCACGCGCCGACTCGCTGCCGGCCTCTAGTCTGCCCCCGCGGCTGC
AGACGCAGGCGACGTCTCTCGTCTCGGCCGAGTACGCGTCTTCGGTCGCTTCGTCATCTCCCTGTGCCTCCATCT
GCGCCGATCTTTCCCTCGAGAGCGACAGAGGGGGGGAAGAGGCCGGCTCGGCCCTCAGCTTGACCAGGAGCCAGT
CGCCTTTGAGGTGGTCTCGTCGGGTTATCATGAATGGTGATGACGAACTGCCTCGTCGCTCGTCATCTCCCCTCA
AGCGACGCGCATCCGGCATGGAAGACTCCGCGTCCGACGCAGGCAACAGGAACTCTGCCGCCGATGGTGACGTCA
ACTCGTCAGGCCGTCACAATCGCGCCATGAGCATCGACGCGCCCGAGACGAACGGCCAAGGGAATACCCAAGGTC
TCTCTCATCGTTCGTATCGCCCGAGCACTCTCCACCTTGTTGTGTACGTGACTAACTCGCCACCAGCATCGCCTC
CACTGCAGGAGCAAATAAAGATAATCGAGACGCTGCTCAAGGCCTCCAACGACTCGCCTCTGATCAAGGACAATG
CCGCCTATCTGGTCTCACGCTCGTGGCTGAACCAGGCGCTCGCTCTACGGTCAGATTCCAAGTCGTCCGGCGGCT
CCGGCCCGGCCGACGCCTCGTTGGGCCCCGTCGACAACTCCGACATTATCGGGGAGACCATCGTCGATTCAAACG
GAAAAACCTTTGTTCGCCTCAAGCCCGGCCTCGGTCTTGAATCTTTCGAGCTCTTCTCCGCCGATGCGTGGAAGC
TGGTAATGGACTGGTACGGATTACGGCAAGGCCAGCACCCCATCATTCGCTTTGCCGTCAATACAGCCGATACCC
ATGACGATCCGCCCAATATCATGTACGAGTTCCACCCGCCCGTCTTCCGCATCCATCGCATATGGTCCGAAGTCA
GCCCCTTGCCGATAGAGCAGTCTCTCAAGGAACGGAATCCGCCGCCCCTGATTGTGGCGACCAGCTCGACCATCA
TCTCTCAGTCGTTTCTCGGGAATCTAAAGACGCTCACCGGCATCCCCATGAACCGCAAAGTCCGCCTGTGGTCGG
TCTCCGTTACCGTCGCTGGCGGACAAGCGGAGCCGCAGGCGACTCTGACGCCCCCAGACTCGCCGACGTCCCAGT
CTGGACAGTCGTGGCAGAACCTGCTGGTCGACCTCCCCAGCTTCTCCCGGGCCGACAAGGCGCAGATACACATGG
CGGACCATACGGCGGACGATAAGTTCAATGGCAGAGCTCCTCTCAAATGCTTCCTCAACCCAAGCGTCGACACGC
TCGTCATCGACGAAGCCGTCAGCGGCAGCTGGGTCAGCACCTTTACGCCAGACAAGGCAGAGAAATCCATCCCCA
CCCGGGTCAACATGGCGGTCGTATCTTCCAAGCTCAACAGTAGCCGGAACAGCCCCACTGAAGGCATGCTCACCC
GCGGCCGGGCTCAAAAGAAGCGGATGGGCCGGATGGATGGGGCCGTGGGCCTGCACAATCTGGGAAACACGTGCT
ACATGAACTCGGCCCTGCAGTGCGTCCGCAGCGTTGAGGAGCTGTCCAAGTACTTCTTGACGGAGTCGCATCTGC
CCGAGATCAACGAAGCAAACGTACTCGGCTTTCAGGGCAAATTGGCCATGGCTTACGGGAATCTTCTCAGGGAGA
TTTATGAGGAAGGGAGAAATGCGGTCAGCCCGCGCGATTTCAAAGCAACGGTCGGGCGCTGCCGTCCCACGTTTT
CTGGATGGGGACAGCAGGACTCGCAGGAGTTTCTAGGTTTCCTCCTCGACGCTCTGCAGGAGGACTTGAGCCGCG
TGAAGAAGAAGCCATATATTGCCAAGCCCGACTCGACGGACGACATGATCAACAATCCCGAGGCCATCCGGCGTA
TGGCAGCCGAGGTCTGGGACATCACTCGACGCCGAGACGATTCGGTCATTGCCGACTTGTTCACGGGCATGTACA
AGTCAACGCTCAAGTGCCCAGAGTGCGGCAAGATCAGCATCACGTTTGACCCCTTTTACAACCTGACGCTGCCGC
TGCCCGCGGAGAGCATGTGGACCAGGCCCGTCAAGTTCTATCCGCTCCACGACGCGCCCGTCATGCTAGACGTGG
AGTTGCCCCAGCACAGCTCCATGGAGAGTCTCAAGAGATTCGTCTCCGCTCGAACTGGCGTTCCCGCCAACCGGA
TGATGGGGGCCGAGGAGTTCAGAGACCGCTTCTTCAAGATATACAACGACACCCATGATGTGTCGGAAGAGGTTT
CGGCCCAAGATATACCGACCTTGCATGAGGTAGAGGCGCCCCCGACGAACTGGCCAGGCAAGGCCCCGCGCAAGA
AGTTCCGGTCCATGCTGGACGTCGACATGCCCCTACACGCCGGCGAGTTCGAAGAAGAGATGAGCCAGGTCATGG
CCGTGCCGGTGTTTTATCGCCGGGCTCGATGCCCCGGCGGTCGGCTCGACGGGTGCGTGCCAGCTCATTTCATCA
CGCTGACGAGGAAAGAGGCTTGCAGCATGGATGCGATTCAGCGCAAGATATTGGTCAAGTTGGCTACCTTTTCCA
CCTGGTCCAAGCTCACCGATGACAACGGCACGTCGGACTCTGGGGATCTGCTCACCACGACGTCTTCCGATGTCG
ATTCTTCCGGTGACAGTAAAATCGCCGCCCGGTCGGTTGAGGGCGAGGATGACATGGTGGACATCTCCATGAGGG
ACTCGCATGCCAAGGCCAGCGGCCAGATAACGCCGCTCAAGACCTTCAGCCGGCGACGGCCCAGGTTCGCTGACC
CTGATGTCTTCCTCGACCCGGAACTCCAGAACCTATTTGAGCTATCGTACTTTCGTCAAGACTCGGACGGTCCTA
TCCCGACCGCCTGGTCGACCTTTGATAACGAGACGGTCCTGGACAAGATGTCGGACCGCGTCCCGGCTGATAGGG
CCAGCATCGGGAGTCCAGACAGCACCATCTCGGGCAACGAGGACAGCAGCAACGCGGACGAGGCGGCAGCGGAGG
CGTCGGTGACGCGCATGACGGAGGAGTCGAGCGACGAGGACGCGTGTCCAGCGGCGAGGGTTCGCACGCCCATCA
GGAGCCTGACGGCCGATTTCCATATGCTGACATTTTACCAGTTCACGAACCGCCCCAGCCGGCATGCCGTGAAGG
GTGGTGCTGGCAATCGCAAGAAGTTTAAGAAACACCAGACCTACGGCAAGAAGGGCAACAAGCGCCGCGATAAAC
AGATGCGCGCGCCCAAGTCCGCGCAGCGTGCGCAGGTGGCTGTCAGTCCCCAGCCCGTGCCGCGGGCCCTGCCCG
ACGGAGGTCCCCTTATCCGCCTGTACGAGGGCATCGTCGTCGACTGGAGCGAGGAGACCTGGGACGTCGTCTTTG
GCGGCACCTCGAAACGCCACGATGCCTTGCGTGGTTCCAAGACTTACATGGACATTGAGACGTTGCACGATCCCG
CCCTCAAGATGAACCAGCGAAGGCGTCAGACGCGCCACAAGGAAGGCATCACGCTGGAGCAGTGTCTGGACGAGT
TTGAGCGCGCCGAAGTCCTTTCGGAGCAGGACATGTGGTTCTGTCCTCGCTGCAAGGAGCACCGGCGAGCGAGCA
AGAAGTTTGACCTGTGGAAGACGCCCGACATACTGGTCGCTCACCTCAAGCGGTTCAGCAACTCGGCCTGGCGGC
GGGAGAAGATAGACGTCCTCGTCGACTTTCCCATAGAAGGACTCGACCTCACGTCGCGAGTGATTGAGAAGGAAG
ACGGTAAGGTGGAGATTTACGACCTGATCGCCATCGACGACCACTATGGCGGTCTGGGCGGAGGCCATTACACCG
CGTACGCCAAGAACTTTGTCGACGGACGCTGGTACAACTTTAACGGTAGGCCTCGGCGCGTGAGGTGATGGACAT
GCTACATGCTAACAGCTGATATGCGCAGACTCTTCGGTCCACGCCGTGTCGGACCCGCAGTCGATGGTGACCAGC
GCCGCATACCTGCTCTTCTACCGACGACGTTCCAACGGACCGCTCGGCGGACCGCGGTTTGCCGAGATCTCGGCC
AAGTACGACGGAGACGTCGGCACGTCTGACGGGGAAAACGTCGAGTCGGGTTCGGACGGTCGGGGAGGCCGGCTG
GCTATCAAGGCTGAGGACGAAGAGACGCTGCCGCCGTACTCGGCGACGATCCGTCGGAGCATCGAAGGCGACGAG
GATCAAGGAGCTGGCGGCTACATTGGGCCGGAAGGAAAGTCACTGGATATGACACAGGGCTGGACCTTTGAAGCT
CTCGAGGAACGCGGAGCTGCAAGGTCGACTGGCGGCGAGTGCGGTAGCGACGACGTGCAGTTCGACTCGAGCGAC
GAAGCCTACCGCGGAGGCGACTGCTTTGAGCAGGACACGGACATGGCGTCGAGCGCGGCCGTCGATGACGGTACG
GCTTGGACTGGCCAGGGGGTGCTCGCGGTGCCTGCGCAAGCCGGCAGCGAGGGTGATTCAGACGAGGTGGCCGAG
ATTCACATCGACGGCGACAGGACAGGGCGTCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail