Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4210
Gene name
LocationContig_388:1634..4358
Strand-
Gene length (bp)2724
Transcript length (bp)2535
Coding sequence length (bp)2535
Protein length (aa) 845

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00233 PDEase_I 3'5'-cyclic nucleotide phosphodiesterase 7.3E-63 347 604

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08499|PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens GN=PDE4D PE=1 SV=2 320 685 1.0E-32
sp|Q01063|PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus GN=Pde4d PE=1 SV=2 320 685 9.0E-32
sp|P14270|PDE4D_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus GN=Pde4d PE=1 SV=4 320 685 3.0E-31
sp|Q23917|PDE2_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA OS=Dictyostelium discoideum GN=regA PE=1 SV=1 287 620 8.0E-30
sp|P06776|PDE2_YEAST 3',5'-cyclic-nucleotide phosphodiesterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDE2 PE=1 SV=2 288 612 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08499|PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens GN=PDE4D PE=1 SV=2 320 685 1.0E-32
sp|Q01063|PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus GN=Pde4d PE=1 SV=2 320 685 9.0E-32
sp|P14270|PDE4D_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus GN=Pde4d PE=1 SV=4 320 685 3.0E-31
sp|Q23917|PDE2_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA OS=Dictyostelium discoideum GN=regA PE=1 SV=1 287 620 8.0E-30
sp|P06776|PDE2_YEAST 3',5'-cyclic-nucleotide phosphodiesterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDE2 PE=1 SV=2 288 612 1.0E-28
sp|P27815|PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens GN=PDE4A PE=1 SV=3 293 612 2.0E-28
sp|O89084|PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus GN=Pde4a PE=1 SV=2 240 622 2.0E-28
sp|Q3UEI1|PDE4C_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Mus musculus GN=Pde4c PE=1 SV=1 320 616 3.0E-28
sp|P54748|PDE4A_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Rattus norvegicus GN=Pde4a PE=1 SV=1 240 622 5.0E-28
sp|Q07343|PDE4B_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Homo sapiens GN=PDE4B PE=1 SV=1 320 622 5.0E-28
sp|P14644|PDE4C_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Fragment) OS=Rattus norvegicus GN=Pde4c PE=2 SV=2 320 616 7.0E-28
sp|P14646|PDE4B_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4B OS=Rattus norvegicus GN=Pde4b PE=1 SV=4 320 622 8.0E-28
sp|Q08493|PDE4C_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4C OS=Homo sapiens GN=PDE4C PE=1 SV=2 320 616 9.0E-28
sp|Q9W4T4|PDE4A_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I OS=Drosophila melanogaster GN=dnc PE=1 SV=2 325 613 6.0E-26
sp|P12252|PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster GN=dnc PE=1 SV=4 325 613 1.0E-25
sp|Q9W4S9|PDE4C_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G OS=Drosophila melanogaster GN=dnc PE=3 SV=2 325 613 2.0E-25
sp|Q8IRU4|PDE4E_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoform F OS=Drosophila melanogaster GN=dnc PE=3 SV=1 325 613 2.0E-25
sp|Q8QZV1|PDE9A_RAT High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Rattus norvegicus GN=Pde9a PE=1 SV=1 346 642 3.0E-25
sp|Q01065|PDE1B_MOUSE Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Mus musculus GN=Pde1b PE=1 SV=2 293 594 5.0E-25
sp|O70628|PDE9A_MOUSE High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Mus musculus GN=Pde9a PE=1 SV=1 346 602 6.0E-25
sp|P54750|PDE1A_HUMAN Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens GN=PDE1A PE=2 SV=2 323 593 7.0E-25
sp|Q01066|PDE1B_RAT Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Rattus norvegicus GN=Pde1b PE=1 SV=1 293 594 7.0E-25
sp|O60658|PDE8A_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Homo sapiens GN=PDE8A PE=1 SV=2 330 624 1.0E-24
sp|P14100|PDE1A_BOVIN Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Bos taurus GN=PDE1A PE=1 SV=3 323 593 1.0E-24
sp|O88502|PDE8A_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A OS=Mus musculus GN=Pde8a PE=1 SV=1 330 624 1.0E-24
sp|Q63421|PDE1C_RAT Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus GN=Pde1c PE=1 SV=1 288 598 2.0E-24
sp|Q22000|PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans GN=pde-4 PE=3 SV=2 320 618 2.0E-24
sp|Q13370|PDE3B_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase B OS=Homo sapiens GN=PDE3B PE=1 SV=2 320 604 2.0E-24
sp|Q01061|PDE1B_BOVIN Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Bos taurus GN=PDE1B PE=1 SV=1 288 594 3.0E-24
sp|Q64338|PDE1C_MOUSE Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Mus musculus GN=Pde1c PE=1 SV=2 288 598 3.0E-24
sp|B0G0Y8|PDE3_DICDI cGMP-specific 3',5'-cGMP phosphodiesterase 3 OS=Dictyostelium discoideum GN=pde3 PE=1 SV=1 288 612 3.0E-24
sp|Q14123|PDE1C_HUMAN Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Homo sapiens GN=PDE1C PE=1 SV=1 288 598 4.0E-24
sp|Q61481|PDE1A_MOUSE Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus GN=Pde1a PE=1 SV=2 323 593 8.0E-24
sp|Q61409|PDE3B_MOUSE cGMP-inhibited 3',5'-cyclic phosphodiesterase B OS=Mus musculus GN=Pde3b PE=1 SV=2 320 587 1.0E-23
sp|H2QL32|PDE9A_PANTR High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Pan troglodytes GN=PDE9A PE=1 SV=1 346 598 2.0E-23
sp|Q9NP56|PDE7B_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 7B OS=Homo sapiens GN=PDE7B PE=1 SV=1 288 595 2.0E-23
sp|Q9QXQ1|PDE7B_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 7B OS=Mus musculus GN=Pde7b PE=1 SV=1 288 592 2.0E-23
sp|O76083|PDE9A_HUMAN High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Homo sapiens GN=PDE9A PE=1 SV=1 346 598 2.0E-23
sp|Q01064|PDE1B_HUMAN Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens GN=PDE1B PE=1 SV=2 293 594 3.0E-23
sp|Q63085|PDE3B_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase B OS=Rattus norvegicus GN=Pde3b PE=2 SV=1 320 587 4.0E-23
sp|Q13946|PDE7A_HUMAN High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A OS=Homo sapiens GN=PDE7A PE=1 SV=2 288 588 2.0E-22
sp|E9Q4S1|PDE8B_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Mus musculus GN=Pde8b PE=1 SV=1 330 625 2.0E-22
sp|Q9HCR9|PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens GN=PDE11A PE=1 SV=2 286 614 5.0E-22
sp|Q62865|PDE3A_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Rattus norvegicus GN=Pde3a PE=1 SV=1 317 587 6.0E-22
sp|O95263|PDE8B_HUMAN High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Homo sapiens GN=PDE8B PE=1 SV=2 330 625 8.0E-22
sp|P0C1Q2|PDE11_MOUSE Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Mus musculus GN=Pde11a PE=1 SV=1 286 641 1.0E-21
sp|P70453|PDE7A_MOUSE High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A OS=Mus musculus GN=Pde7a PE=2 SV=2 288 588 1.0E-21
sp|Q8VID6|PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus GN=Pde11a PE=1 SV=1 286 614 1.0E-21
sp|O08593|PDE7A_RAT High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (Fragment) OS=Rattus norvegicus GN=Pde7a PE=2 SV=1 288 588 2.0E-21
sp|Q14432|PDE3A_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens GN=PDE3A PE=1 SV=3 317 587 4.0E-21
sp|B3LVW5|PDE6_DROAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila ananassae GN=Pde6 PE=3 SV=1 290 596 8.0E-21
sp|Q9Z0X4|PDE3A_MOUSE cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Mus musculus GN=Pde3a PE=1 SV=1 317 587 1.0E-20
sp|B4PSS5|PDE6_DROYA cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila yakuba GN=Pde6 PE=3 SV=1 290 596 1.0E-20
sp|B4QZU1|PDE6_DROSI cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila simulans GN=Pde6 PE=3 SV=1 290 596 1.0E-20
sp|B3P3K2|PDE6_DROER cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila erecta GN=Pde6 PE=3 SV=1 290 596 1.0E-20
sp|Q9VFI9|PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster GN=Pde6 PE=1 SV=4 290 596 1.0E-20
sp|Q9N2V9|PDE6_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-6 OS=Caenorhabditis elegans GN=pde-6 PE=3 SV=1 313 608 1.0E-20
sp|B4NAL6|PDE6_DROWI cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila willistoni GN=Pde6 PE=3 SV=1 290 596 2.0E-20
sp|B4K9L4|PDE6_DROMO cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila mojavensis GN=Pde6 PE=3 SV=1 283 596 2.0E-20
sp|Q298P4|PDE6_DROPS cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila pseudoobscura pseudoobscura GN=Pde6 PE=3 SV=3 281 596 2.0E-20
sp|B4JXX2|PDE6_DROGR cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila grimshawi GN=Pde6 PE=3 SV=1 290 596 9.0E-20
sp|B4LVU6|PDE6_DROVI cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila virilis GN=Pde6 PE=3 SV=1 290 596 1.0E-19
sp|Q8I0P7|PDE3_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-3 OS=Caenorhabditis elegans GN=pde-3 PE=3 SV=4 320 617 1.0E-19
sp|P91119|PDE5_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-5 OS=Caenorhabditis elegans GN=pde-5 PE=3 SV=3 307 635 3.0E-19
sp|Q64395|PDE1B_CRIGR Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B (Fragment) OS=Cricetulus griseus GN=PDE1B1 PE=2 SV=1 323 544 8.0E-19
sp|O18696|PDE1_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans GN=pde-1 PE=3 SV=2 320 598 2.0E-18
sp|Q1KKS3|PDE11_TAKRU Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Takifugu rubripes GN=pde11a PE=3 SV=1 286 635 3.0E-18
sp|P30645|PDE2_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-2 OS=Caenorhabditis elegans GN=pde-2 PE=3 SV=4 291 731 1.0E-17
sp|O00408|PDE2A_HUMAN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Homo sapiens GN=PDE2A PE=1 SV=1 289 596 2.0E-14
sp|P16499|PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens GN=PDE6A PE=1 SV=4 288 649 2.0E-14
sp|Q01062|PDE2A_RAT cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus GN=Pde2a PE=1 SV=2 289 596 3.0E-14
sp|Q922S4|PDE2A_MOUSE cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Mus musculus GN=Pde2a PE=1 SV=3 289 596 3.0E-14
sp|P16586|PDE6C_BOVIN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Bos taurus GN=PDE6C PE=1 SV=1 299 640 3.0E-14
sp|P14099|PDE2A_BOVIN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus GN=PDE2A PE=1 SV=2 289 596 4.0E-14
sp|Q9VJ79|PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster GN=Pde11 PE=1 SV=4 264 609 1.0E-13
sp|O77746|PDE5A_CANLF cGMP-specific 3',5'-cyclic phosphodiesterase OS=Canis lupus familiaris GN=PDE5A PE=2 SV=1 282 594 1.0E-13
sp|P33726|PDE6B_CANLF Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Canis lupus familiaris GN=PDE6B PE=1 SV=1 288 645 1.0E-13
sp|O76074|PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens GN=PDE5A PE=1 SV=2 297 594 1.0E-13
sp|Q91ZQ1|PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus GN=Pde6c PE=2 SV=1 291 626 1.0E-13
sp|P27664|PDE6A_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Mus musculus GN=Pde6a PE=2 SV=3 283 625 2.0E-13
sp|P23440|PDE6B_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Mus musculus GN=Pde6b PE=2 SV=3 288 621 3.0E-13
sp|P51160|PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens GN=PDE6C PE=1 SV=2 320 640 3.0E-13
sp|Q28156|PDE5A_BOVIN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Bos taurus GN=PDE5A PE=1 SV=1 297 594 3.0E-13
sp|P23439|PDE6B_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Bos taurus GN=PDE6B PE=1 SV=1 288 625 4.0E-13
sp|Q28263|PDE6A_CANLF Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Canis lupus familiaris GN=PDE6A PE=2 SV=2 288 645 5.0E-13
sp|P11541|PDE6A_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Bos taurus GN=PDE6A PE=1 SV=3 288 645 6.0E-13
sp|Q86H13|PDE4_DICDI cAMP-specific 3',5'-cAMP phosphodiesterase 4 OS=Dictyostelium discoideum GN=Pde4 PE=1 SV=2 320 492 9.0E-13
sp|Q8CG03|PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus GN=Pde5a PE=1 SV=2 282 594 1.0E-12
sp|P35913|PDE6B_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Homo sapiens GN=PDE6B PE=1 SV=2 288 625 2.0E-12
sp|O54735|PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus GN=Pde5a PE=2 SV=1 297 594 4.0E-12
sp|Q9Y233|PDE10_HUMAN cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Homo sapiens GN=PDE10A PE=1 SV=1 328 596 3.0E-11
sp|P52731|PDE6C_CHICK Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Gallus gallus GN=PDE6C PE=1 SV=1 286 609 5.0E-11
sp|Q9QYJ6|PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus GN=Pde10a PE=1 SV=1 328 596 3.0E-10
sp|Q8CA95|PDE10_MOUSE cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Mus musculus GN=Pde10a PE=1 SV=2 328 596 3.0E-10
sp|B4G4E5|PDE6_DROPE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila persimilis GN=Pde6 PE=3 SV=1 281 467 8.0E-10
sp|B4HEM4|PDE6_DROSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila sechellia GN=Pde6 PE=3 SV=1 290 458 8.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004114 3',5'-cyclic-nucleotide phosphodiesterase activity Yes
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0004112 cyclic-nucleotide phosphodiesterase activity No
GO:0008081 phosphoric diester hydrolase activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4210
MDRIPCHVVYVDRAVGEDRLVRSRARDADGKLDRVGQLVQPLLDAFGDVFVCATGEACLAKLIQLQDRVMTDPTP
TLVLLDTPHDDAFSTLSSPVSPTSPLHAEPPSPPGGREIRRPDEELYGLTLLQKLVTEAHLRNVSKLIIPVPVLG
LSDPAAAVTGPMTDGAVETSGLGLLYAHRPLLRKCLDIGAVDVIISPLSAACIATLEMCAYKARRDATREQQALL
EFAKGRKRSWVGVNEQKPYAYLREAMVSGLMRGICRLDHDDGRIAGAHIAVSLERQTALALAVGSWHFCAHSFTD
DELLVAAMLMFKHALAMPELEVWRVPTKQLISFLVACRAAYNTFVPYHNFRHVVDVLQATFNFLVHIGTLPPYPR
AEEVDDAPRPESVIGRLLTPFEGLTLLITAIGHDVGHPGVNNGFLSTLNAPLAQLYNDRSVLESFHCAAYSQILR
RYWPAVFEDRKMRNLMISSILSTDMGLHFDYMRKLGDLQDRLRQDPDAASGWNVRQVDEHKVLACSLLIKCADIS
NVARQHDAALQWMHILSEEFSRQASMEDELEIKSSLLAPPKKDMASLAKAQLGFMNLFAIPLFQGVADIVPAMRY
TVDELEINKRLFEQKLEEAKAPEEATPSLSSRGGEEDPPSPRTKSFARSQDTEKAGVNGSTMLDDVERQDGQPLP
FPSGQASEPPDLSGTKQVPLSVDAIRELAADGDPFRCRADSCGDSKICFRQRCSETTEGSISCRLTNDWQSQDTT
GQQALSPSTQGTSIVSNESLERTVSGCGPDGWTRGPNPQTVATDVHVPTLSAPVPTPGKTVKKRPSRFRMKDFAL
FRKNKGNNSPTLPAADATN*
Coding >Ophun1|4210
ATGGACCGCATCCCGTGTCACGTCGTCTACGTCGACCGCGCCGTCGGGGAGGATAGGCTCGTCCGGTCACGAGCC
CGCGACGCTGATGGGAAGCTGGATCGCGTTGGGCAATTGGTCCAGCCGCTCCTCGATGCCTTTGGCGACGTCTTC
GTTTGCGCCACTGGCGAGGCTTGCCTGGCCAAGCTCATCCAGCTCCAGGACAGGGTCATGACGGATCCGACTCCC
ACCCTCGTCCTGCTCGATACGCCTCACGACGATGCGTTCTCGACCCTCTCTTCGCCCGTCTCGCCCACCTCGCCC
CTACACGCCGAGCCGCCATCGCCCCCCGGCGGCCGCGAGATCCGCCGGCCGGATGAGGAGCTCTACGGCTTGACG
CTGCTGCAGAAGCTCGTCACCGAGGCTCACCTGCGCAACGTCTCCAAGCTCATCATCCCCGTGCCCGTCCTCGGC
CTTTCCGACCCGGCCGCCGCCGTCACCGGCCCCATGACGGACGGCGCCGTCGAGACGTCGGGCCTGGGCCTCCTC
TACGCCCACCGCCCGCTACTGCGCAAGTGTCTCGACATTGGGGCCGTCGACGTCATCATCAGCCCCTTGAGCGCC
GCGTGCATCGCGACTCTGGAGATGTGCGCTTACAAGGCCCGCCGGGACGCGACCAGGGAGCAGCAGGCGCTTCTC
GAGTTCGCAAAGGGCCGCAAAAGGTCATGGGTCGGCGTCAACGAGCAGAAGCCCTACGCCTACCTGCGCGAGGCC
ATGGTCTCGGGCCTCATGAGGGGCATCTGCCGCCTCGATCACGACGACGGCCGCATCGCCGGCGCCCACATCGCC
GTATCCCTCGAGCGCCAGACTGCCCTGGCCCTGGCCGTCGGTAGCTGGCATTTCTGCGCCCACTCCTTCACCGAC
GACGAGCTGCTCGTCGCCGCCATGCTCATGTTCAAGCATGCGCTCGCCATGCCCGAGCTCGAGGTCTGGCGCGTG
CCCACCAAGCAGCTCATCAGCTTCCTCGTCGCCTGTCGCGCCGCCTACAACACCTTTGTCCCCTACCACAACTTT
CGCCACGTCGTCGACGTTCTCCAGGCCACCTTCAACTTCCTCGTTCACATCGGCACCCTGCCGCCCTATCCGCGG
GCCGAAGAGGTCGACGACGCGCCACGGCCCGAGTCGGTCATTGGCCGTCTCCTGACCCCCTTTGAGGGCCTGACG
CTACTCATTACGGCCATCGGCCACGACGTCGGCCATCCGGGCGTTAACAACGGCTTCCTGTCGACGCTCAACGCG
CCGCTCGCCCAGCTGTACAATGACCGGTCCGTGCTCGAGTCGTTCCACTGCGCCGCCTACTCGCAGATCCTCAGG
CGGTATTGGCCTGCCGTCTTCGAGGACCGCAAGATGCGCAACCTGATGATCAGCTCCATCCTCTCCACCGACATG
GGCCTGCACTTTGATTACATGAGGAAGCTCGGCGACCTGCAGGACAGGCTGCGCCAGGATCCCGACGCCGCCTCG
GGATGGAACGTGCGTCAGGTGGACGAGCACAAGGTGCTGGCCTGCTCGCTGCTCATCAAGTGTGCAGACATAAGC
AACGTGGCGAGGCAGCATGACGCGGCGCTGCAGTGGATGCACATTCTCTCGGAGGAATTCTCCCGGCAGGCCTCG
ATGGAGGACGAGTTGGAGATCAAGTCGTCGCTGCTGGCGCCGCCCAAGAAGGACATGGCGTCGCTGGCCAAGGCT
CAGCTCGGCTTCATGAACCTATTCGCCATCCCCCTGTTCCAGGGCGTGGCCGACATCGTGCCGGCCATGCGGTAT
ACGGTAGACGAGCTCGAGATCAACAAGAGGCTTTTCGAGCAGAAGCTGGAGGAAGCCAAGGCACCAGAAGAGGCC
ACGCCGTCGCTATCGTCTCGAGGCGGTGAGGAGGACCCCCCATCGCCGAGGACGAAGAGCTTTGCGCGCAGTCAG
GACACGGAGAAGGCGGGCGTCAACGGCTCGACGATGCTCGACGACGTGGAACGCCAGGACGGCCAGCCGCTGCCA
TTCCCGTCGGGGCAAGCGTCGGAGCCGCCGGATTTAAGCGGTACGAAGCAGGTGCCCCTGTCGGTCGACGCGATA
CGGGAGCTGGCAGCGGACGGCGATCCCTTTCGCTGCCGGGCCGACAGCTGCGGCGACAGCAAGATTTGCTTCCGT
CAGCGCTGCAGCGAGACGACCGAGGGCAGCATATCGTGTCGGTTGACCAACGACTGGCAGTCTCAAGACACGACG
GGGCAGCAGGCGCTGTCCCCCAGCACGCAGGGCACCAGCATCGTTAGCAACGAGTCGCTGGAGAGGACCGTCAGC
GGCTGCGGACCCGACGGCTGGACCCGCGGGCCGAACCCGCAGACGGTGGCGACGGACGTCCACGTCCCGACCCTT
TCGGCGCCGGTGCCGACGCCGGGAAAGACGGTCAAGAAGCGGCCGAGCCGGTTTCGGATGAAGGACTTTGCCCTT
TTTAGGAAGAATAAGGGGAACAACAGCCCGACGCTGCCGGCGGCCGACGCGACCAACTGA
Transcript >Ophun1|4210
ATGGACCGCATCCCGTGTCACGTCGTCTACGTCGACCGCGCCGTCGGGGAGGATAGGCTCGTCCGGTCACGAGCC
CGCGACGCTGATGGGAAGCTGGATCGCGTTGGGCAATTGGTCCAGCCGCTCCTCGATGCCTTTGGCGACGTCTTC
GTTTGCGCCACTGGCGAGGCTTGCCTGGCCAAGCTCATCCAGCTCCAGGACAGGGTCATGACGGATCCGACTCCC
ACCCTCGTCCTGCTCGATACGCCTCACGACGATGCGTTCTCGACCCTCTCTTCGCCCGTCTCGCCCACCTCGCCC
CTACACGCCGAGCCGCCATCGCCCCCCGGCGGCCGCGAGATCCGCCGGCCGGATGAGGAGCTCTACGGCTTGACG
CTGCTGCAGAAGCTCGTCACCGAGGCTCACCTGCGCAACGTCTCCAAGCTCATCATCCCCGTGCCCGTCCTCGGC
CTTTCCGACCCGGCCGCCGCCGTCACCGGCCCCATGACGGACGGCGCCGTCGAGACGTCGGGCCTGGGCCTCCTC
TACGCCCACCGCCCGCTACTGCGCAAGTGTCTCGACATTGGGGCCGTCGACGTCATCATCAGCCCCTTGAGCGCC
GCGTGCATCGCGACTCTGGAGATGTGCGCTTACAAGGCCCGCCGGGACGCGACCAGGGAGCAGCAGGCGCTTCTC
GAGTTCGCAAAGGGCCGCAAAAGGTCATGGGTCGGCGTCAACGAGCAGAAGCCCTACGCCTACCTGCGCGAGGCC
ATGGTCTCGGGCCTCATGAGGGGCATCTGCCGCCTCGATCACGACGACGGCCGCATCGCCGGCGCCCACATCGCC
GTATCCCTCGAGCGCCAGACTGCCCTGGCCCTGGCCGTCGGTAGCTGGCATTTCTGCGCCCACTCCTTCACCGAC
GACGAGCTGCTCGTCGCCGCCATGCTCATGTTCAAGCATGCGCTCGCCATGCCCGAGCTCGAGGTCTGGCGCGTG
CCCACCAAGCAGCTCATCAGCTTCCTCGTCGCCTGTCGCGCCGCCTACAACACCTTTGTCCCCTACCACAACTTT
CGCCACGTCGTCGACGTTCTCCAGGCCACCTTCAACTTCCTCGTTCACATCGGCACCCTGCCGCCCTATCCGCGG
GCCGAAGAGGTCGACGACGCGCCACGGCCCGAGTCGGTCATTGGCCGTCTCCTGACCCCCTTTGAGGGCCTGACG
CTACTCATTACGGCCATCGGCCACGACGTCGGCCATCCGGGCGTTAACAACGGCTTCCTGTCGACGCTCAACGCG
CCGCTCGCCCAGCTGTACAATGACCGGTCCGTGCTCGAGTCGTTCCACTGCGCCGCCTACTCGCAGATCCTCAGG
CGGTATTGGCCTGCCGTCTTCGAGGACCGCAAGATGCGCAACCTGATGATCAGCTCCATCCTCTCCACCGACATG
GGCCTGCACTTTGATTACATGAGGAAGCTCGGCGACCTGCAGGACAGGCTGCGCCAGGATCCCGACGCCGCCTCG
GGATGGAACGTGCGTCAGGTGGACGAGCACAAGGTGCTGGCCTGCTCGCTGCTCATCAAGTGTGCAGACATAAGC
AACGTGGCGAGGCAGCATGACGCGGCGCTGCAGTGGATGCACATTCTCTCGGAGGAATTCTCCCGGCAGGCCTCG
ATGGAGGACGAGTTGGAGATCAAGTCGTCGCTGCTGGCGCCGCCCAAGAAGGACATGGCGTCGCTGGCCAAGGCT
CAGCTCGGCTTCATGAACCTATTCGCCATCCCCCTGTTCCAGGGCGTGGCCGACATCGTGCCGGCCATGCGGTAT
ACGGTAGACGAGCTCGAGATCAACAAGAGGCTTTTCGAGCAGAAGCTGGAGGAAGCCAAGGCACCAGAAGAGGCC
ACGCCGTCGCTATCGTCTCGAGGCGGTGAGGAGGACCCCCCATCGCCGAGGACGAAGAGCTTTGCGCGCAGTCAG
GACACGGAGAAGGCGGGCGTCAACGGCTCGACGATGCTCGACGACGTGGAACGCCAGGACGGCCAGCCGCTGCCA
TTCCCGTCGGGGCAAGCGTCGGAGCCGCCGGATTTAAGCGGTACGAAGCAGGTGCCCCTGTCGGTCGACGCGATA
CGGGAGCTGGCAGCGGACGGCGATCCCTTTCGCTGCCGGGCCGACAGCTGCGGCGACAGCAAGATTTGCTTCCGT
CAGCGCTGCAGCGAGACGACCGAGGGCAGCATATCGTGTCGGTTGACCAACGACTGGCAGTCTCAAGACACGACG
GGGCAGCAGGCGCTGTCCCCCAGCACGCAGGGCACCAGCATCGTTAGCAACGAGTCGCTGGAGAGGACCGTCAGC
GGCTGCGGACCCGACGGCTGGACCCGCGGGCCGAACCCGCAGACGGTGGCGACGGACGTCCACGTCCCGACCCTT
TCGGCGCCGGTGCCGACGCCGGGAAAGACGGTCAAGAAGCGGCCGAGCCGGTTTCGGATGAAGGACTTTGCCCTT
TTTAGGAAGAATAAGGGGAACAACAGCCCGACGCTGCCGGCGGCCGACGCGACCAACTGA
Gene >Ophun1|4210
ATGGACCGCATCCCGTGTCACGTCGTCTACGTCGACCGCGCCGTCGGGGAGGATAGGCTCGTCCGGTCACGAGCC
CGCGACGCTGATGGGAAGCTGGATCGCGTTGGGCAATTGGTCCAGCCGCTCCTCGATGCCTTTGGCGACGGTCCG
TTCTTCCTCTACGCCCCCCTCTCGATTTCCCTTGCTCACTCACGGTCGTTGCAGTCTTCGTTTGCGCCACTGGCG
AGGCTTGCCTGGCCAAGCTCATCCAGCTCCAGGACAGGGTCATGACGGATCCGACTCCCACCCTCGTCCTGCTCG
ATACGCCTCACGACGATGCGTTCTCGACCCTCTCTTCGCCCGTCTCGCCCACCTCGCCCCTACACGCCGAGCCGC
CATCGCCCCCCGGCGGCCGCGAGATCCGCCGGCCGGATGAGGAGCTCTACGGCTTGACGCTGCTGCAGAAGCTCG
TCACCGAGGCTCACCTGCGCAACGTCTCCAAGCTCATCATCCCCGTGCCCGTCCTCGGCCTTTCCGACCCGGCCG
CCGCCGTCACCGGCCCCATGACGGACGGCGCCGTCGAGACGTCGGGCCTGGGCCTCCTCTACGCCCACCGCCCGC
TACTGCGCAAGTGTCTCGACATTGGGGCCGTCGACGTCATCATCAGCCCCTTGAGCGCCGCGTGCATCGCGACTC
TGGAGATGTGCGCTTACAAGGCCCGCCGGGACGCGACCAGGGAGCAGCAGGCGCTTCTCGAGTTCGCAAAGGGCC
GCAAAAGGTCATGGGTCGGCGTCAACGAGCAGAAGCCCTACGCCTACCTGCGCGAGGCCATGGTCTCGGGCCTCA
TGAGGGGCATCTGCCGCCTCGATCACGACGACGGCCGCATCGCCGGCGCCCACATCGCCGTATCCCTCGAGCGCC
AGACTGCCCTGGCCCTGGCCGTCGGTAGCTGGCATTTCTGCGCCCACTCCTTCACCGACGACGAGCTGCTCGTCG
CCGCCATGCTCATGTTCAAGCATGCGCTCGCCATGCCCGAGCTCGAGGTCTGGCGCGTGCCCACCAGTGAGTGCT
TCCTTTCTCTCGTACTTCCACACTCGATTGGACTCGTTACTGACGGGACCTCGGCTCAGAGCAGCTCATCAGCTT
CCTCGTCGCCTGTCGCGCCGCCTACAACACCTTTGTCCCCTACCACAACTTTCGCCACGTCGTCGACGTTCTCCA
GGCCACCTTCAACTTCCTCGTTCACATCGGCACCCTGCCGCCCTATCCGCGGGCCGAAGAGGTCGACGACGCGCC
ACGGCCCGAGTCGGTCATTGGCCGTCTCCTGACCCCCTTTGAGGGCCTGACGCTACTCATTACGGCCATCGGCCA
CGACGTCGGCCATCCGGGCGTTAACAACGGCTTCCTGTCGACGCTCAACGCGCCGCTCGCCCAGCTGTACAATGA
CCGGTCCGTGCTCGAGTCGTTCCACTGCGCCGCCTACTCGCAGATCCTCAGGCGGTATTGGCCTGCCGTCTTCGA
GGACCGCAAGATGCGCAACCTGATGATCAGCTCCATCCTCTCCACCGACATGGGCCTGCACTTTGATTACATGAG
GAAGCTCGGCGACCTGCAGGACAGGCTGCGCCAGGATCCCGACGCCGCCTCGGGATGGAACGTGCGTCAGGTGGA
CGAGCACAAGGTGCTGGCCTGCTCGCTGCTCATCAAGTGTGCAGACATAAGCAACGTGGTGAGTCTCTTCCCTCT
GCCGAAGATGATCTTTTGACGGTCACGGCTGACGCTGGACCATAGGCGAGGCAGCATGACGCGGCGCTGCAGTGG
ATGCACATTCTCTCGGAGGAATTCTCCCGGCAGGCCTCGATGGAGGACGAGTTGGAGATCAAGTCGTCGCTGCTG
GCGCCGCCCAAGAAGGACATGGCGTCGCTGGCCAAGGCTCAGCTCGGCTTCATGAACCTATTCGCCATCCCCCTG
TTCCAGGGCGTGGCCGACATCGTGCCGGCCATGCGGTATACGGTAGACGAGCTCGAGATCAACAAGAGGCTTTTC
GAGCAGAAGCTGGAGGAAGCCAAGGCACCAGAAGAGGCCACGCCGTCGCTATCGTCTCGAGGCGGTGAGGAGGAC
CCCCCATCGCCGAGGACGAAGAGCTTTGCGCGCAGTCAGGACACGGAGAAGGCGGGCGTCAACGGCTCGACGATG
CTCGACGACGTGGAACGCCAGGACGGCCAGCCGCTGCCATTCCCGTCGGGGCAAGCGTCGGAGCCGCCGGATTTA
AGCGGTACGAAGCAGGTGCCCCTGTCGGTCGACGCGATACGGGAGCTGGCAGCGGACGGCGATCCCTTTCGCTGC
CGGGCCGACAGCTGCGGCGACAGCAAGATTTGCTTCCGTCAGCGCTGCAGCGAGACGACCGAGGGCAGCATATCG
TGTCGGTTGACCAACGACTGGCAGTCTCAAGACACGACGGGGCAGCAGGCGCTGTCCCCCAGCACGCAGGGCACC
AGCATCGTTAGCAACGAGTCGCTGGAGAGGACCGTCAGCGGCTGCGGACCCGACGGCTGGACCCGCGGGCCGAAC
CCGCAGACGGTGGCGACGGACGTCCACGTCCCGACCCTTTCGGCGCCGGTGCCGACGCCGGGAAAGACGGTCAAG
AAGCGGCCGAGCCGGTTTCGGATGAAGGACTTTGCCCTTTTTAGGAAGAATAAGGGGAACAACAGCCCGACGCTG
CCGGCGGCCGACGCGACCAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail