Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4200
Gene name
LocationContig_386:11737..13477
Strand+
Gene length (bp)1740
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 8.0E-35 44 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 2 578 5.0E-161
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 12 425 4.0E-27
sp|Q70CQ3|UBP30_HUMAN Ubiquitin carboxyl-terminal hydrolase 30 OS=Homo sapiens GN=USP30 PE=1 SV=1 26 576 6.0E-14
sp|Q3UN04|UBP30_MOUSE Ubiquitin carboxyl-terminal hydrolase 30 OS=Mus musculus GN=Usp30 PE=1 SV=1 26 576 6.0E-14
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 44 340 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 2 578 5.0E-161
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 12 425 4.0E-27
sp|Q70CQ3|UBP30_HUMAN Ubiquitin carboxyl-terminal hydrolase 30 OS=Homo sapiens GN=USP30 PE=1 SV=1 26 576 6.0E-14
sp|Q3UN04|UBP30_MOUSE Ubiquitin carboxyl-terminal hydrolase 30 OS=Mus musculus GN=Usp30 PE=1 SV=1 26 576 6.0E-14
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 44 340 2.0E-12
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 44 340 3.0E-12
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 44 340 5.0E-12
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 44 340 5.0E-12
sp|D3ZPG5|UBP30_RAT Ubiquitin carboxyl-terminal hydrolase 30 OS=Rattus norvegicus GN=Usp30 PE=3 SV=1 26 404 4.0E-10
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 14 289 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0006508 proteolysis No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4200
MMPDRSVTVVSYAAGASLAAVALIYVFGPTFTIDNDGSRKKTIVGLRNNANDCFINSVLQALAGLGELRTYLIRE
THRRNIEDAAVYRNLVQPDDGVKLEAWKLQGLQMGIVTQGLKDMLDALNERPIAKKSVTPFPFVKVLEAAFKQRI
SRQQQDAQEFLQIVAERLKDEYRAGQRARARARDAPGGDASEGDASEGGAPRGTATGRHSPSPDPDEPESEPNEG
FPMEGKYESRLMCQTCHYKTKPREEGFCTMTLAVPHVQSTTLNSCFDGIFKTEFIDDFKCEMCRLLQAKANLEHE
LTRSTSPEFRAQARENIDKLSAAIDTDPERPPEDVDLGDMRYAPKRRISKTTRMSIFPKILAVHLSRSIYGVGQT
TQKNSAKVAFPERLPLGGISEPHQYKLLGIITHRGGHNSGHYEAFRRQNQSFPYPNANTFQQSEVYSKASTPVST
PKMKARQVGGGGSPADSTTDLLSTTAEPPPRSVPAAEASSSPPPAEGRTEGNGDGGSLRSVAASTKSALSKLTAP
RQGQSAMAGRRAKRRKPTSDKWWRVSDEKVREAKTSEVLGMQREVYMLFYELDD*
Coding >Ophun1|4200
ATGATGCCGGACCGGTCGGTGACGGTCGTTTCGTACGCGGCCGGTGCCTCCCTTGCCGCCGTGGCCCTCATCTAC
GTCTTCGGCCCGACCTTTACCATCGACAACGACGGCTCCCGCAAGAAGACCATCGTCGGTCTGCGCAACAACGCA
AACGATTGCTTCATCAACTCGGTCCTTCAGGCCCTCGCCGGCCTGGGCGAGCTGCGGACCTACCTCATCCGCGAA
ACTCATCGGCGCAACATCGAGGATGCCGCCGTATACCGGAACCTGGTTCAGCCCGATGACGGCGTCAAGCTCGAG
GCCTGGAAGCTGCAGGGCCTGCAGATGGGCATCGTCACTCAGGGACTCAAGGACATGTTGGACGCGCTTAATGAG
CGGCCCATTGCCAAGAAGTCGGTGACGCCCTTTCCCTTTGTCAAGGTGCTCGAGGCGGCTTTCAAGCAGCGCATT
AGTAGGCAGCAGCAGGATGCGCAAGAGTTTCTTCAGATTGTCGCCGAGCGCCTCAAGGACGAGTATCGCGCCGGT
CAGCGCGCCCGCGCCCGCGCCCGCGATGCACCCGGAGGCGACGCATCCGAAGGCGACGCATCCGAAGGCGGTGCT
CCTCGCGGGACCGCTACCGGTCGCCATTCTCCTTCTCCCGACCCAGACGAGCCCGAGTCGGAGCCCAACGAGGGC
TTCCCCATGGAGGGCAAATACGAGTCTCGCCTCATGTGCCAGACGTGCCACTACAAGACGAAGCCGAGGGAGGAG
GGCTTCTGCACCATGACGCTGGCCGTGCCGCACGTGCAGTCGACCACGCTCAACTCGTGCTTCGACGGCATCTTT
AAGACGGAGTTCATCGACGACTTCAAGTGCGAAATGTGCCGCCTCCTGCAGGCCAAGGCCAACCTCGAGCACGAG
CTGACGCGGTCAACGTCGCCCGAGTTCAGAGCCCAGGCGCGGGAGAATATCGACAAGCTCAGCGCCGCCATCGAC
ACGGATCCCGAGCGGCCGCCCGAGGACGTCGACCTGGGCGACATGCGGTACGCGCCCAAGCGGAGGATCTCAAAG
ACGACGCGCATGTCCATCTTCCCCAAGATCCTGGCCGTCCACCTGTCGCGGTCCATCTACGGCGTCGGACAGACG
ACGCAGAAGAACTCGGCCAAGGTGGCCTTTCCGGAGCGGCTGCCGTTGGGCGGCATCTCCGAACCGCACCAGTAT
AAGCTGCTGGGCATCATCACGCACCGGGGCGGTCATAACAGCGGCCACTACGAGGCCTTTCGGCGGCAGAACCAG
TCGTTCCCCTACCCCAACGCCAACACGTTTCAGCAGTCCGAGGTGTACAGCAAGGCCTCGACGCCCGTGTCGACG
CCAAAGATGAAGGCCCGGCAGGTGGGAGGCGGCGGCAGCCCGGCCGACTCGACGACGGATCTCCTCTCGACGACG
GCCGAGCCCCCGCCGCGCAGCGTCCCGGCAGCCGAGGCGAGCTCATCGCCGCCACCGGCCGAGGGGCGGACGGAG
GGGAACGGCGACGGAGGCAGCCTGCGGTCGGTGGCGGCGTCGACCAAGTCGGCGCTATCGAAGCTGACGGCGCCC
AGACAGGGCCAGTCGGCCATGGCCGGTCGTCGAGCCAAGAGGCGCAAGCCGACGTCGGACAAGTGGTGGCGCGTC
AGCGACGAAAAGGTGCGAGAGGCCAAGACGAGCGAGGTGCTGGGCATGCAGCGGGAGGTGTACATGCTGTTTTAC
GAGCTGGACGATTAG
Transcript >Ophun1|4200
ATGATGCCGGACCGGTCGGTGACGGTCGTTTCGTACGCGGCCGGTGCCTCCCTTGCCGCCGTGGCCCTCATCTAC
GTCTTCGGCCCGACCTTTACCATCGACAACGACGGCTCCCGCAAGAAGACCATCGTCGGTCTGCGCAACAACGCA
AACGATTGCTTCATCAACTCGGTCCTTCAGGCCCTCGCCGGCCTGGGCGAGCTGCGGACCTACCTCATCCGCGAA
ACTCATCGGCGCAACATCGAGGATGCCGCCGTATACCGGAACCTGGTTCAGCCCGATGACGGCGTCAAGCTCGAG
GCCTGGAAGCTGCAGGGCCTGCAGATGGGCATCGTCACTCAGGGACTCAAGGACATGTTGGACGCGCTTAATGAG
CGGCCCATTGCCAAGAAGTCGGTGACGCCCTTTCCCTTTGTCAAGGTGCTCGAGGCGGCTTTCAAGCAGCGCATT
AGTAGGCAGCAGCAGGATGCGCAAGAGTTTCTTCAGATTGTCGCCGAGCGCCTCAAGGACGAGTATCGCGCCGGT
CAGCGCGCCCGCGCCCGCGCCCGCGATGCACCCGGAGGCGACGCATCCGAAGGCGACGCATCCGAAGGCGGTGCT
CCTCGCGGGACCGCTACCGGTCGCCATTCTCCTTCTCCCGACCCAGACGAGCCCGAGTCGGAGCCCAACGAGGGC
TTCCCCATGGAGGGCAAATACGAGTCTCGCCTCATGTGCCAGACGTGCCACTACAAGACGAAGCCGAGGGAGGAG
GGCTTCTGCACCATGACGCTGGCCGTGCCGCACGTGCAGTCGACCACGCTCAACTCGTGCTTCGACGGCATCTTT
AAGACGGAGTTCATCGACGACTTCAAGTGCGAAATGTGCCGCCTCCTGCAGGCCAAGGCCAACCTCGAGCACGAG
CTGACGCGGTCAACGTCGCCCGAGTTCAGAGCCCAGGCGCGGGAGAATATCGACAAGCTCAGCGCCGCCATCGAC
ACGGATCCCGAGCGGCCGCCCGAGGACGTCGACCTGGGCGACATGCGGTACGCGCCCAAGCGGAGGATCTCAAAG
ACGACGCGCATGTCCATCTTCCCCAAGATCCTGGCCGTCCACCTGTCGCGGTCCATCTACGGCGTCGGACAGACG
ACGCAGAAGAACTCGGCCAAGGTGGCCTTTCCGGAGCGGCTGCCGTTGGGCGGCATCTCCGAACCGCACCAGTAT
AAGCTGCTGGGCATCATCACGCACCGGGGCGGTCATAACAGCGGCCACTACGAGGCCTTTCGGCGGCAGAACCAG
TCGTTCCCCTACCCCAACGCCAACACGTTTCAGCAGTCCGAGGTGTACAGCAAGGCCTCGACGCCCGTGTCGACG
CCAAAGATGAAGGCCCGGCAGGTGGGAGGCGGCGGCAGCCCGGCCGACTCGACGACGGATCTCCTCTCGACGACG
GCCGAGCCCCCGCCGCGCAGCGTCCCGGCAGCCGAGGCGAGCTCATCGCCGCCACCGGCCGAGGGGCGGACGGAG
GGGAACGGCGACGGAGGCAGCCTGCGGTCGGTGGCGGCGTCGACCAAGTCGGCGCTATCGAAGCTGACGGCGCCC
AGACAGGGCCAGTCGGCCATGGCCGGTCGTCGAGCCAAGAGGCGCAAGCCGACGTCGGACAAGTGGTGGCGCGTC
AGCGACGAAAAGGTGCGAGAGGCCAAGACGAGCGAGGTGCTGGGCATGCAGCGGGAGGTGTACATGCTGTTTTAC
GAGCTGGACGATTAG
Gene >Ophun1|4200
ATGATGCCGGACCGGTCGGTGACGGTCGTTTCGTACGCGGCCGGTGCCTCCCTTGCCGCCGTGGCCCTCATCTAC
GTCTTCGGCCCGACCTTTACCATCGACAACGACGGCTCCCGCAAGAAGACCATCGTCGGTCTGCGCAACAACGCA
AACGATTGCTTCATCAACTCGGTCCTTCAGGCCCTCGCCGGCCTGGGCGAGCTGCGGACCTACCTCATCCGCGAA
ACTCATCGGCGCAACATCGAGGATGCCGCCGTATACCGGAACCTGGTTCAGCCCGATGACGGCGTCAAGCTCGAG
GCCTGGAAGCTGCAGGGCCTGCAGATGGGCATCGTCACTCAGGGACTCAAGGACATGTTGGACGCGCTTAATGAG
CGGCCCATTGCCAAGAAGTCGGTGACGCCCTTTCCCTTTGTCAAGGTGCTCGAGGCGGCTTTCAAGCAGCGCATT
AGTAGGCAGCAGCAGGATGCGCAAGAGTTTCTTCAGATTGTCGCCGAGCGCCTCAAGGACGAGTATCGCGCCGGT
CAGCGCGCCCGCGCCCGCGCCCGCGATGCACCCGGAGGCGACGCATCCGAAGGCGACGCATCCGAAGGCGGTGCT
CCTCGCGGGACCGCTACCGGTCGCCATTCTCCTTCTCCCGACCCAGACGAGCCCGAGTCGGAGCCCAACGAGGGC
TTCCCCATGGAGGGCAAATACGAGTCTCGCCTCATGTGCCAGACGTGCCACTACAAGACGAAGCCGAGGGAGGAG
GGCTTCTGCACCATGACGCTGGCCGTGCCGCACGTGCAGTCGACCACGCTCAACTCGTGCTTCGACGGCATCTTT
AAGACGGAGTTCATCGACGACTTCAAGTGCGAAATGTGCCGCCTCCTGCAGGCCAAGGCCAACCTCGAGCACGAG
CTGACGCGGTCAACGTCGCCCGAGTTCAGAGCCCAGGCGCGGGAGAATATCGACAAGCTCAGCGCCGCCATCGAC
ACGGATCCCGAGCGGCCGCCCGAGGACGTCGACCTGGGCGACATGCGGTACGCGCCCAAGCGGAGGATCTCAAAG
ACGACGCGCATGTCCATCTTCCCCAAGATCCTGGCCGTCCACCTGTCGCGGTCCATCTACGGCGTCGGACAGACG
ACGCAGAAGAACTCGGCCAAGGTGGCCTTTCCGGAGCGGCTGCCGTTGGGCGGCATCTCCGAACCGCACCAGTAT
AAGCTGCTGGGCATCATCACGCACCGGGGCGGTCATAACAGCGGCCACTACGAGGCCTTTCGGCGGCAGAACCAG
TCGTTCCCCTACCCCAACGCCAACACGTTTCAGCAGTCCGAGGTGTACAGCAAGGCCTCGACGCCCGTGTCGACG
CCAAAGATGAAGGCCCGGCAGGTGGGAGGCGGCGGCAGCCCGGCCGACTCGACGACGGATCTCCTCTCGACGACG
GCCGAGCCCCCGCCGCGCAGCGTCCCGGCAGCCGAGGCGAGCTCATCGCCGCCACCGGCCGAGGGGCGGACGGAG
GGGAACGGCGACGGAGGCAGCCTGCGGTCGGTGGCGGCGTCGACCAAGTCGGCGCTATCGAAGCTGACGGCGCCC
AGACAGGGCCAGTCGGCCATGGCCGGTCGTCGAGCCAAGAGGCGCAAGCCGACGTCGGACAAGTGGTGGCGCGTC
AGCGACGAAAAGGTGCGAGAGGCCAAGACGAGCGAGGTGCTGGGCATGCAGCGGGAGGTGTACATGCTGTTTTAC
GAGCTGGACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail