Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|42
Gene name
LocationContig_1:111325..112365
Strand-
Gene length (bp)1040
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03896 TRAP_alpha Translocon-associated protein (TRAP), alpha subunit 3.9E-08 58 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5M501|IR222_CANTT Increased recombination centers protein 22-2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-2 PE=3 SV=1 57 250 7.0E-17
sp|B9WCP3|IRC22_CANDC Increased recombination centers protein 22 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=IRC22 PE=3 SV=1 58 258 2.0E-16
sp|C4YKP5|IR221_CANAW Increased recombination centers protein 22-1 OS=Candida albicans (strain WO-1) GN=IRC22-1 PE=3 SV=1 58 258 1.0E-12
sp|Q59YF4|IR221_CANAL Increased recombination centers protein 22-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-1 PE=3 SV=1 58 258 4.0E-12
sp|Q59XW9|IR222_CANAL Increased recombination centers protein 22-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-2 PE=3 SV=1 58 258 9.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5M501|IR222_CANTT Increased recombination centers protein 22-2 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-2 PE=3 SV=1 57 250 7.0E-17
sp|B9WCP3|IRC22_CANDC Increased recombination centers protein 22 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=IRC22 PE=3 SV=1 58 258 2.0E-16
sp|C4YKP5|IR221_CANAW Increased recombination centers protein 22-1 OS=Candida albicans (strain WO-1) GN=IRC22-1 PE=3 SV=1 58 258 1.0E-12
sp|Q59YF4|IR221_CANAL Increased recombination centers protein 22-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-1 PE=3 SV=1 58 258 4.0E-12
sp|Q59XW9|IR222_CANAL Increased recombination centers protein 22-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-2 PE=3 SV=1 58 258 9.0E-12
sp|P0CH79|IR222_CANAW Increased recombination centers protein 22-2 OS=Candida albicans (strain WO-1) GN=IRC22-2 PE=3 SV=1 58 258 9.0E-12
sp|A5DYV2|IRC22_LODEL Increased recombination centers protein 22 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=IRC22 PE=3 SV=1 58 257 2.0E-11
sp|C5M580|IR221_CANTT Increased recombination centers protein 22-1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=IRC22-1 PE=3 SV=1 57 250 3.0E-10
sp|Q6BW93|IRC22_DEBHA Increased recombination centers protein 22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IRC22 PE=3 SV=1 55 256 2.0E-08
sp|A3LU17|IRC22_PICST Increased recombination centers protein 22 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=IRC22 PE=3 SV=1 58 256 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 175 197 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|42
MAIDSLLSPSKLALLAAWAWGAKADGESPPPPPKPAQLAADIKTTFPDADILGVHLVNGRPTKALVEVKNKEVGP
IKVAYLTGALIGTQPLPADAPAYQAILRNLTAVQYNLEIAAGEAKALPFSFMLDMQPQDVRLQLVAVVADAKGNI
VQVPAHNGTASIVEAPTSFFDPQIIFLYLVLSAAFASTLYFVYKTWIEALFPQAKRTKPAKKGKKAADADAALST
ADSSAVSPGAGKTYDESWIPDHHIKPPVAKRVKSGVGSSKKKGVE*
Coding >Ophun1|42
ATGGCTATCGATAGTCTCTTATCCCCCTCCAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGCCGAT
GGCGAATCTCCCCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGACATCAAGACAACCTTCCCAGACGCCGAC
ATCCTGGGCGTTCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGGTCAAGAACAAGGAGGTGGGCCCC
ATCAAGGTGGCCTACCTGACCGGCGCCCTGATCGGCACCCAGCCGTTGCCAGCAGACGCACCGGCCTACCAGGCC
ATTCTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCGGCGGGGGAGGCCAAGGCTTTGCCATTTTCG
TTTATGCTGGATATGCAGCCTCAGGATGTTCGGCTTCAGCTTGTGGCTGTTGTTGCCGATGCCAAGGGGAATATC
GTTCAGGTGCCGGCTCATAACGGGACGGCATCGATAGTCGAGGCTCCTACGAGCTTCTTTGATCCTCAGATCATC
TTTCTCTACCTCGTTCTGTCAGCCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAGACCTGGATCGAAGCCCTC
TTTCCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAAAAAAGCAGCCGATGCCGACGCCGCGCTCTCCACC
GCAGATTCATCCGCCGTCTCGCCCGGCGCCGGAAAGACGTACGATGAGAGCTGGATTCCCGATCATCATATTAAG
CCTCCTGTTGCCAAGCGCGTCAAGTCTGGCGTCGGCAGCAGCAAGAAGAAGGGTGTTGAATAG
Transcript >Ophun1|42
ATGGCTATCGATAGTCTCTTATCCCCCTCCAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGCCGAT
GGCGAATCTCCCCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGACATCAAGACAACCTTCCCAGACGCCGAC
ATCCTGGGCGTTCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGGTCAAGAACAAGGAGGTGGGCCCC
ATCAAGGTGGCCTACCTGACCGGCGCCCTGATCGGCACCCAGCCGTTGCCAGCAGACGCACCGGCCTACCAGGCC
ATTCTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCGGCGGGGGAGGCCAAGGCTTTGCCATTTTCG
TTTATGCTGGATATGCAGCCTCAGGATGTTCGGCTTCAGCTTGTGGCTGTTGTTGCCGATGCCAAGGGGAATATC
GTTCAGGTGCCGGCTCATAACGGGACGGCATCGATAGTCGAGGCTCCTACGAGCTTCTTTGATCCTCAGATCATC
TTTCTCTACCTCGTTCTGTCAGCCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAGACCTGGATCGAAGCCCTC
TTTCCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAAAAAAGCAGCCGATGCCGACGCCGCGCTCTCCACC
GCAGATTCATCCGCCGTCTCGCCCGGCGCCGGAAAGACGTACGATGAGAGCTGGATTCCCGATCATCATATTAAG
CCTCCTGTTGCCAAGCGCGTCAAGTCTGGCGTCGGCAGCAGCAAGAAGAAGGGTGTTGAATAG
Gene >Ophun1|42
ATGGCTATCGATAGTCTCTTATCCCCCTCCAAGCTGGCTCTCTTGGCCGCCTGGGCCTGGGGCGCAAAGGTGAGG
AGGAGCTTGGGATTGGGTTTCGCGGCTTGGCGGCTTTTTCTTTTGACCTGTTGATTGAGTTTTTGGCTTTGGCAT
CCTCGTTTTGCCCTTCCTATCTGTCTCGATTCATCCGAGAGAGAAAAAAAAGATCAAAAGGCTGACCGACGGAAA
ATGTCCTCGAGATAGGCCGATGGCGAATCTCCCCCTCCGCCTCCCAAGCCAGCCCAGCTGGCAGCCGACATCAAG
ACAACCTTCCCAGACGCCGACATCCTGGGCGTTCACCTCGTCAACGGCCGGCCAACCAAGGCGCTCGTCGAGGTC
AAGAACAAGGAGGTGGGCCCCATCAAGGTGGCCTACCTGACCGGCGCCCTGATCGGCACCCAGCCGTTGCCAGCA
GACGCACCGGCCTACCAGGCCATTCTCCGCAACCTGACGGCGGTGCAGTACAATCTTGAGATTGCGGCGGGGGAG
GCCAAGGCTTTGCCATTTTCGTTTATGCTGGATATGCAGCCTCAGGATGTTCGGCTTCAGCTTGTGGCTGTTGTT
GCCGATGCCAAGGGGAATATCGTTCAGGTGCCGGCTCATAACGGGACGGCATCGATAGTCGAGGCTCCTACGAGC
TTCTTTGATCCTCAGATGTGCGTCCTCGTTCTTTACCCTTCACTTTGTCAAGAATTTGCTGATATCCGCTTAGCA
TCTTTCTCTACCTCGTTCTGTCAGCCGCCTTTGCCAGCACGCTCTACTTTGTCTACAAGACCTGGATCGAAGCCC
TCTTTCCTCAGGCTAAGCGCACCAAGCCAGCCAAGAAGGGCAAAAAAGCAGCCGATGCCGACGCCGCGCTCTCCA
CCGCAGATTCATCCGCCGTCTCGCCCGGCGCCGGAAAGACGTACGATGAGAGCTGGATTCCCGATCATCATATTA
AGCCTCCTGTTGCCAAGCGCGTCAAGTCTGGCGTCGGCAGCAGCAAGAAGAAGGGTGTTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail