Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4197
Gene name
LocationContig_386:4342..5135
Strand-
Gene length (bp)793
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05837 CENP-H Centromere protein H (CENP-H) 1.6E-28 100 218

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000776 kinetochore Yes
GO:0051382 kinetochore assembly Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0009987 cellular process No
GO:0140694 non-membrane-bounded organelle assembly No
GO:0051383 kinetochore organization No
GO:0043933 protein-containing complex organization No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0043229 intracellular organelle No
GO:0099080 supramolecular complex No
GO:0043226 organelle No
GO:0070925 organelle assembly No
GO:0065003 protein-containing complex assembly No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0051276 chromosome organization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4197
MDKVDEEPQPQTALSLSSDEQRVLDLFDTIQQLRIEMAIVRALQTGNSGASEPLRDDLLEARAKLKLRNDAIEAV
MMANPILRAVHNGTDASPIERHADLLPFVERRDEAAVAVAGQASDMESIRSQLTVIHSETVRVTRHNVELTAELC
DLADQLRRRKVGSGLGSPGTRSAVTQLEQQVANRRKRWRAIKGVVSGVVCGSGIDWADDDELRGMVLDPEDEDER
L*
Coding >Ophun1|4197
ATGGACAAGGTCGACGAAGAGCCCCAGCCACAGACGGCTCTGTCTTTGTCTTCGGACGAGCAGCGAGTCCTCGAT
CTCTTCGACACGATACAGCAGCTGAGAATCGAGATGGCCATCGTCAGGGCGCTGCAAACAGGGAACTCGGGCGCG
TCAGAACCACTGCGGGATGATCTCCTCGAAGCGCGGGCCAAGCTCAAGCTGCGCAACGACGCCATCGAGGCCGTC
ATGATGGCCAACCCGATCCTCAGGGCCGTCCACAACGGCACCGACGCGTCTCCCATAGAACGGCACGCAGATTTG
CTTCCCTTTGTGGAGCGTAGGGATGAGGCTGCCGTCGCCGTCGCCGGACAGGCCTCAGACATGGAGTCGATCCGC
AGCCAGCTGACCGTCATTCATTCGGAAACGGTGCGCGTCACTCGTCACAACGTCGAGCTTACAGCCGAGCTCTGC
GACTTGGCGGATCAGTTGCGACGGCGGAAAGTCGGGTCCGGCCTCGGCTCGCCGGGGACGCGCAGTGCCGTCACG
CAGCTCGAGCAGCAGGTCGCGAACCGCAGGAAGCGATGGAGGGCCATCAAGGGCGTCGTCAGCGGTGTCGTCTGC
GGGAGCGGTATCGACTGGGCTGACGACGACGAGCTGCGCGGAATGGTGCTCGATCCCGAAGACGAAGACGAACGA
CTGTGA
Transcript >Ophun1|4197
ATGGACAAGGTCGACGAAGAGCCCCAGCCACAGACGGCTCTGTCTTTGTCTTCGGACGAGCAGCGAGTCCTCGAT
CTCTTCGACACGATACAGCAGCTGAGAATCGAGATGGCCATCGTCAGGGCGCTGCAAACAGGGAACTCGGGCGCG
TCAGAACCACTGCGGGATGATCTCCTCGAAGCGCGGGCCAAGCTCAAGCTGCGCAACGACGCCATCGAGGCCGTC
ATGATGGCCAACCCGATCCTCAGGGCCGTCCACAACGGCACCGACGCGTCTCCCATAGAACGGCACGCAGATTTG
CTTCCCTTTGTGGAGCGTAGGGATGAGGCTGCCGTCGCCGTCGCCGGACAGGCCTCAGACATGGAGTCGATCCGC
AGCCAGCTGACCGTCATTCATTCGGAAACGGTGCGCGTCACTCGTCACAACGTCGAGCTTACAGCCGAGCTCTGC
GACTTGGCGGATCAGTTGCGACGGCGGAAAGTCGGGTCCGGCCTCGGCTCGCCGGGGACGCGCAGTGCCGTCACG
CAGCTCGAGCAGCAGGTCGCGAACCGCAGGAAGCGATGGAGGGCCATCAAGGGCGTCGTCAGCGGTGTCGTCTGC
GGGAGCGGTATCGACTGGGCTGACGACGACGAGCTGCGCGGAATGGTGCTCGATCCCGAAGACGAAGACGAACGA
CTGTGA
Gene >Ophun1|4197
ATGGACAAGGTCGACGAAGAGCCCCAGCCACAGACGGCTCTGTCTTTGTCTTCGGACGAGCAGCGAGTCCTCGAT
CTCTTCGACACGATACAGCAGCTGAGAATCGAGATGGCCATCGTCAGGGCGCTGCAAACAGGTGCGATATGCCAG
ACGAGCAACGCCGGGCCCGAACCGCACTGAATCTCGGCTTTCGTGTCAGGGAACTCGGGCGCGTCAGAACCACTG
CGGGATGATCTCCTCGAAGCGCGGGCCAAGCTCAAGCTGCGCAACGACGCCATCGAGGCCGTCATGATGGCCAAC
CCGATCCTCAGGGCCGTCCACAACGGCACCGACGCGTCTCCCATAGAACGGCACGCGTGTCTCTCGATGAAAACG
CGCTCCAAGTTCTAACGCTGCTATATATAGAGATTTGCTTCCCTTTGTGGAGCGTAGGGATGAGGCTGCCGTCGC
CGTCGCCGGACAGGCCTCAGACATGGAGTCGATCCGCAGCCAGCTGACCGTCATTCATTCGGAAACGGTGCGCGT
CACTCGTCACAACGTCGAGCTTACAGCCGAGCTCTGCGACTTGGCGGATCAGTTGCGACGGCGGAAAGTCGGGTC
CGGCCTCGGCTCGCCGGGGACGCGCAGTGCCGTCACGCAGCTCGAGCAGCAGGTCGCGAACCGCAGGAAGCGATG
GAGGGCCATCAAGGGCGTCGTCAGCGGTGTCGTCTGCGGGAGCGGTATCGACTGGGCTGACGACGACGAGCTGCG
CGGAATGGTGCTCGATCCCGAAGACGAAGACGAACGACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail