Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4193
Gene name
LocationContig_385:7753..9636
Strand-
Gene length (bp)1883
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-10 28 142
PF07690 MFS_1 Major Facilitator Superfamily 3.7E-10 203 468

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 58 80 22
3 85 107 22
4 117 139 22
5 202 224 22
6 239 261 22
7 330 352 22
8 378 400 22
9 407 429 22
10 444 466 22
11 529 551 22
12 561 578 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4193
MSSVSRFLPFSASVTTAQATTYLLGVSLFSISFLVFLNSSVSFVITDLIGQKENVGDVVGTLGFADELVALVACP
AWGLVSDRLGVRWVATIGYAIIGLALAVFVQARNVYPQLLLARLFFAVGASASATMVTAILPSLTDEADPVTAAS
GPSRFKHHARLSAAFSVESEATITPERYTRTLSQERTRGPTSAAKHGKPSALAGFVGSFTGCGALVSLALFLPLP
ARFGRIDGVTPGRAVEYSFYVVAAVSLAVALFVSIGLRNLRGEEGKGWKALFGMRSRYDALDRPEQDDARRRPKR
DVLPYLGLMRDSVWLGLTDSRIAMGYIGGFVARASTVAISLFIPLLVNTFFIDNGFCHGSPNDPSPELKKECRAA
YVLSSILTGVAQLMGLVCAPLFGYLSGRARRINYPVVAASSLGIIGYMTLPHLSSPEVTDVDGRGGTPAILVVVA
AVGVSQIGAIVCSLGSLGQGVLEAELPPSAIGDQSAVDEAETEADDEDEDDDGAVESDPLVSAPAESEPSSRVRL
KGSIAGIYSLCGGAAILILTKVGGLLFDRLSHGAPFYMMAGFNAIWLVASLLLDASQAYAAS*
Coding >Ophun1|4193
ATGTCGTCCGTCTCGCGATTCCTGCCCTTCTCGGCTTCGGTGACAACGGCCCAGGCGACGACGTATCTGCTGGGC
GTCTCGCTCTTCTCCATCTCCTTTCTCGTCTTCCTCAACAGCTCTGTGTCGTTTGTGATTACCGACCTGATCGGC
CAAAAGGAAAATGTCGGCGATGTCGTCGGAACCCTGGGCTTCGCCGACGAGCTGGTAGCTCTGGTGGCCTGTCCG
GCTTGGGGACTCGTCTCGGACCGGCTGGGCGTTCGCTGGGTGGCGACCATCGGCTACGCCATCATCGGTCTCGCG
TTGGCCGTCTTCGTTCAGGCTCGGAATGTGTATCCTCAGCTGCTGCTCGCCCGCCTGTTCTTCGCAGTCGGAGCC
TCGGCATCCGCCACCATGGTCACCGCCATACTCCCCTCGCTGACGGACGAGGCTGATCCCGTGACGGCCGCGTCG
GGGCCTTCGCGCTTCAAGCACCACGCCCGACTCAGCGCCGCCTTTTCCGTCGAGTCCGAAGCCACCATCACGCCC
GAGAGATACACCAGGACGCTGTCCCAGGAGCGGACGCGGGGCCCGACGTCGGCGGCTAAGCACGGGAAGCCATCG
GCGCTGGCCGGCTTCGTCGGCTCCTTTACGGGCTGCGGCGCTCTCGTCTCGCTGGCTCTGTTCCTGCCGCTGCCG
GCGAGGTTTGGCCGGATCGACGGCGTCACGCCCGGGAGAGCCGTCGAGTACAGCTTCTACGTGGTAGCGGCTGTG
TCTCTGGCCGTCGCTCTCTTTGTTTCTATCGGATTGCGCAACTTGAGGGGTGAAGAAGGGAAAGGCTGGAAAGCG
CTGTTTGGCATGCGTAGTCGATACGATGCTCTCGACCGGCCCGAGCAGGACGACGCGCGCAGGAGACCGAAGAGG
GACGTGCTTCCCTACCTTGGCTTGATGAGGGACTCGGTCTGGCTAGGCTTGACGGATTCGAGGATAGCCATGGGC
TATATCGGCGGCTTCGTTGCGAGGGCGTCTACCGTGGCCATCTCCCTCTTCATCCCGCTGCTGGTCAACACCTTC
TTCATCGATAATGGCTTCTGCCACGGCTCGCCTAACGATCCGTCACCCGAGCTGAAGAAAGAATGCCGGGCGGCC
TACGTTCTGTCGTCGATCCTGACGGGAGTCGCTCAGCTGATGGGTCTCGTGTGTGCGCCCCTGTTCGGCTATCTG
TCGGGGCGGGCTAGACGGATCAACTATCCCGTGGTGGCGGCCAGCTCGCTAGGCATCATCGGATACATGACGCTG
CCTCACCTATCGAGCCCCGAGGTGACGGATGTGGACGGACGGGGCGGCACACCGGCCATCCTGGTCGTCGTCGCG
GCTGTGGGCGTCAGCCAGATCGGGGCTATCGTCTGCAGCCTGGGGTCACTGGGACAGGGAGTCCTCGAGGCGGAA
CTGCCGCCATCAGCTATCGGCGACCAGTCGGCTGTCGATGAGGCTGAGACCGAGGCCGACGATGAAGACGAAGAC
GACGACGGGGCCGTCGAGTCGGATCCGCTCGTATCCGCACCGGCCGAAAGCGAGCCGTCGTCTAGGGTGCGGCTC
AAGGGCTCGATTGCCGGCATCTACTCGCTCTGCGGGGGCGCGGCCATCCTGATCCTCACCAAGGTTGGAGGCCTG
CTGTTTGACCGGCTGTCGCACGGGGCGCCGTTTTACATGATGGCCGGCTTCAACGCCATATGGCTCGTGGCCAGC
CTGCTGCTGGACGCCTCGCAGGCTTACGCAGCTAGCTGA
Transcript >Ophun1|4193
ATGTCGTCCGTCTCGCGATTCCTGCCCTTCTCGGCTTCGGTGACAACGGCCCAGGCGACGACGTATCTGCTGGGC
GTCTCGCTCTTCTCCATCTCCTTTCTCGTCTTCCTCAACAGCTCTGTGTCGTTTGTGATTACCGACCTGATCGGC
CAAAAGGAAAATGTCGGCGATGTCGTCGGAACCCTGGGCTTCGCCGACGAGCTGGTAGCTCTGGTGGCCTGTCCG
GCTTGGGGACTCGTCTCGGACCGGCTGGGCGTTCGCTGGGTGGCGACCATCGGCTACGCCATCATCGGTCTCGCG
TTGGCCGTCTTCGTTCAGGCTCGGAATGTGTATCCTCAGCTGCTGCTCGCCCGCCTGTTCTTCGCAGTCGGAGCC
TCGGCATCCGCCACCATGGTCACCGCCATACTCCCCTCGCTGACGGACGAGGCTGATCCCGTGACGGCCGCGTCG
GGGCCTTCGCGCTTCAAGCACCACGCCCGACTCAGCGCCGCCTTTTCCGTCGAGTCCGAAGCCACCATCACGCCC
GAGAGATACACCAGGACGCTGTCCCAGGAGCGGACGCGGGGCCCGACGTCGGCGGCTAAGCACGGGAAGCCATCG
GCGCTGGCCGGCTTCGTCGGCTCCTTTACGGGCTGCGGCGCTCTCGTCTCGCTGGCTCTGTTCCTGCCGCTGCCG
GCGAGGTTTGGCCGGATCGACGGCGTCACGCCCGGGAGAGCCGTCGAGTACAGCTTCTACGTGGTAGCGGCTGTG
TCTCTGGCCGTCGCTCTCTTTGTTTCTATCGGATTGCGCAACTTGAGGGGTGAAGAAGGGAAAGGCTGGAAAGCG
CTGTTTGGCATGCGTAGTCGATACGATGCTCTCGACCGGCCCGAGCAGGACGACGCGCGCAGGAGACCGAAGAGG
GACGTGCTTCCCTACCTTGGCTTGATGAGGGACTCGGTCTGGCTAGGCTTGACGGATTCGAGGATAGCCATGGGC
TATATCGGCGGCTTCGTTGCGAGGGCGTCTACCGTGGCCATCTCCCTCTTCATCCCGCTGCTGGTCAACACCTTC
TTCATCGATAATGGCTTCTGCCACGGCTCGCCTAACGATCCGTCACCCGAGCTGAAGAAAGAATGCCGGGCGGCC
TACGTTCTGTCGTCGATCCTGACGGGAGTCGCTCAGCTGATGGGTCTCGTGTGTGCGCCCCTGTTCGGCTATCTG
TCGGGGCGGGCTAGACGGATCAACTATCCCGTGGTGGCGGCCAGCTCGCTAGGCATCATCGGATACATGACGCTG
CCTCACCTATCGAGCCCCGAGGTGACGGATGTGGACGGACGGGGCGGCACACCGGCCATCCTGGTCGTCGTCGCG
GCTGTGGGCGTCAGCCAGATCGGGGCTATCGTCTGCAGCCTGGGGTCACTGGGACAGGGAGTCCTCGAGGCGGAA
CTGCCGCCATCAGCTATCGGCGACCAGTCGGCTGTCGATGAGGCTGAGACCGAGGCCGACGATGAAGACGAAGAC
GACGACGGGGCCGTCGAGTCGGATCCGCTCGTATCCGCACCGGCCGAAAGCGAGCCGTCGTCTAGGGTGCGGCTC
AAGGGCTCGATTGCCGGCATCTACTCGCTCTGCGGGGGCGCGGCCATCCTGATCCTCACCAAGGTTGGAGGCCTG
CTGTTTGACCGGCTGTCGCACGGGGCGCCGTTTTACATGATGGCCGGCTTCAACGCCATATGGCTCGTGGCCAGC
CTGCTGCTGGACGCCTCGCAGGCTTACGCAGCTAGCTGA
Gene >Ophun1|4193
ATGTCGTCCGTCTCGCGATTCCTGCCCTTCTCGGCTTCGGTGACAACGGCCCAGGCGACGACGTATCTGCTGGGC
GTCTCGCTCTTCTCCATCTCCTTTCTCGTCTTCCTCAACAGCTCTGTGTCGTTTGTGATTACCGACCTGATCGGC
CAAAAGGAAAATGTCGGCGATGTCGTCGGAACCCTGGGCTTCGCCGACGAGCTGGTAGCTCTGGTGGCCTGTCCG
GCTTGGGGACTCGTCTCGGACCGGCTGGGCGTTCGCTGGGTGGCGACCATCGGCTACGCCATCATCGGTCTCGCG
TTGGCCGTCTTCGTTCAGGCTCGGAATGTGTATCCTCAGCTGCTGCTCGCCCGCCTGTTCTTCGCAGTCGGAGCC
TCGGCATCGTGAGTTATTTGCTGCGCCCCGGTGACGAACTGAGATGGGCTGACGGCGACACGTAGCGCCACCATG
GTCACCGCCATACTCCCCTCGCTGACGGACGAGGCTGATCCCGTGACGGCCGCGTCGGGGCCTTCGCGCTTCAAG
CACCACGCCCGACTCAGCGCCGCCTTTTCCGTCGAGTCCGAAGCCACCATCACGCCCGAGAGATACACCAGGACG
CTGTCCCAGGAGCGGACGCGGGGCCCGACGTCGGCGGCTAAGCACGGGAAGCCATCGGCGCTGGCCGGCTTCGTC
GGCTCCTTTACGGGCTGCGGCGCTCTCGTCTCGCTGGCTCTGTTCCTGCCGCTGCCGGCGAGGTTTGGCCGGATC
GACGGCGTCACGCCCGGGAGAGCCGTCGAGTACAGCTTCTACGTGGTAGCGGCTGTGTCTCTGGCCGTCGCTCTC
TTTGTTTCTATCGGATTGCGCAACTTGAGGGGTGAAGAAGGGAAAGGCTGGAAAGCGCTGTTTGGCATGCGTAGT
CGATACGATGCTCTCGACCGGCCCGAGCAGGACGACGCGCGCAGGAGACCGAAGAGGGTAGGGGGCTTTTCTCTC
GGCCGCAGGTCATGGACATCAGGTGGGCTGACTGGCTGCCGCAGGACGTGCTTCCCTACCTTGGCTTGATGAGGG
ACTCGGTCTGGCTAGGCTTGACGGATTCGAGGATAGCCATGGGCTATATCGGCGGCTTCGTTGCGAGGGCGTCTA
CCGTGGCCATCTCCCTCTTCATCCCGCTGCTGGTCAACACCTTCTTCATCGATAATGGCTTCTGCCACGGCTCGC
CTAACGATCCGTCACCCGAGCTGAAGAAAGAATGCCGGGCGGCCTACGTTCTGTCGTCGATCCTGACGGGAGTCG
CTCAGCTGATGGGTCTCGTGTGTGCGCCCCTGTTCGGCTATCTGTCGGGGCGGGCTAGACGGATCAACTATCCCG
TGGTGGCGGCCAGCTCGCTAGGCATCATCGGATACATGACGCTGCCTCACCTATCGAGCCCCGAGGTGACGGATG
TGGACGGACGGGGCGGCACACCGGCCATCCTGGTCGTCGTCGCGGCTGTGGGCGTCAGCCAGATCGGGGCTATCG
TCTGCAGCCTGGGGTCACTGGGACAGGGAGTCCTCGAGGCGGAACTGCCGCCATCAGCTATCGGCGACCAGTCGG
CTGTCGATGAGGCTGAGACCGAGGCCGACGATGAAGACGAAGACGACGACGGGGCCGTCGAGTCGGATCCGCTCG
TATCCGCACCGGCCGAAAGCGAGCCGTCGTCTAGGGTGCGGCTCAAGGGCTCGATTGCCGGCATCTACTCGCTCT
GCGGGGGCGCGGCCATCCTGATCCTCACCAAGGTTGGAGGCCTGCTGTTTGACCGGCTGTCGCACGGGGCGCCGT
TTTACATGATGGCCGGCTTCAACGCCATATGGCTCGTGGCCAGCCTGCTGCTGGACGCCTCGCAGGCTTACGCAG
CTAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail