Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|419
Gene name
LocationContig_1118:284..604
Strand+
Gene length (bp)320
Transcript length (bp)261
Coding sequence length (bp)261
Protein length (aa) 87

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5532
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4157
Ophiocordyceps camponoti-floridani Ophcf2|06155
Ophiocordyceps camponoti-rufipedis Ophun1|419 (this protein)
Ophiocordyceps kimflemingae Ophio5|4852
Ophiocordyceps subramaniannii Hirsu2|6916

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|419
MRLGAPSLPLMPCRLLPNERCGADERYLGNCPVRLRVDNLRDDKGLTMGTDKYIRVAASPDSYLNVTFHERECPE
DKDMAKLNLEL*
Coding >Ophun1|419
ATGCGCCTCGGGGCTCCATCATTGCCGCTGATGCCCTGCCGTTTGCTACCAAATGAGCGTTGCGGTGCCGACGAG
CGTTATCTAGGCAACTGTCCCGTCCGGCTGCGCGTCGACAACCTCCGTGATGACAAGGGTTTGACCATGGGGACT
GACAAGTATATCCGCGTTGCCGCCTCGCCCGACAGTTACCTCAACGTCACCTTTCACGAGAGGGAGTGTCCGGAG
GACAAGGACATGGCCAAGCTGAACCTTGAGTTGTAG
Transcript >Ophun1|419
ATGCGCCTCGGGGCTCCATCATTGCCGCTGATGCCCTGCCGTTTGCTACCAAATGAGCGTTGCGGTGCCGACGAG
CGTTATCTAGGCAACTGTCCCGTCCGGCTGCGCGTCGACAACCTCCGTGATGACAAGGGTTTGACCATGGGGACT
GACAAGTATATCCGCGTTGCCGCCTCGCCCGACAGTTACCTCAACGTCACCTTTCACGAGAGGGAGTGTCCGGAG
GACAAGGACATGGCCAAGCTGAACCTTGAGTTGTAG
Gene >Ophun1|419
ATGCGCCTCGGGGCTCCATCATTGCCGCTGATGCCCTGCCGTTTGCTACCAGTAGGCTTCTGTTCGCCTCGGCTT
CCAACTCCAAGTACTACGTCAACTTCTGGGGGGAGAATGAGCGTTGCGGTGCCGACGAGCGTTATCTAGGCAACT
GTCCCGTCCGGCTGCGCGTCGACAACCTCCGTGATGACAAGGGTTTGACCATGGGGACTGACAAGTATATCCGCG
TTGCCGCCTCGCCCGACAGTTACCTCAACGTCACCTTTCACGAGAGGGAGTGTCCGGAGGACAAGGACATGGCCA
AGCTGAACCTTGAGTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail