Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4185
Gene name
LocationContig_384:5920..7569
Strand+
Gene length (bp)1649
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04506 Rft-1 Rft protein 1.7E-15 9 105
PF04506 Rft-1 Rft protein 9.0E-86 87 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6S3|RFT1_YARLI Oligosaccharide translocation protein RFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RFT1 PE=3 SV=1 82 355 2.0E-49
sp|P38206|RFT1_YEAST Oligosaccharide translocation protein RFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFT1 PE=1 SV=1 9 350 6.0E-40
sp|P40913|RFT1_KLULA Oligosaccharide translocation protein RFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RFT1 PE=3 SV=2 87 379 2.0E-37
sp|Q754Q7|RFT1_ASHGO Oligosaccharide translocation protein RFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RFT1 PE=3 SV=1 75 420 2.0E-36
sp|Q5A6N8|RFT1_CANAL Oligosaccharide translocation protein RFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFT1 PE=3 SV=1 87 415 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6S3|RFT1_YARLI Oligosaccharide translocation protein RFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RFT1 PE=3 SV=1 82 355 2.0E-49
sp|P38206|RFT1_YEAST Oligosaccharide translocation protein RFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFT1 PE=1 SV=1 9 350 6.0E-40
sp|P40913|RFT1_KLULA Oligosaccharide translocation protein RFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RFT1 PE=3 SV=2 87 379 2.0E-37
sp|Q754Q7|RFT1_ASHGO Oligosaccharide translocation protein RFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RFT1 PE=3 SV=1 75 420 2.0E-36
sp|Q5A6N8|RFT1_CANAL Oligosaccharide translocation protein RFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFT1 PE=3 SV=1 87 415 2.0E-35
sp|Q6FPE8|RFT1_CANGA Oligosaccharide translocation protein RFT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RFT1 PE=3 SV=1 89 379 4.0E-35
sp|O94302|RFT1_SCHPO Oligosaccharide translocation protein rft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rft1 PE=3 SV=1 123 350 2.0E-32
sp|Q96AA3|RFT1_HUMAN Protein RFT1 homolog OS=Homo sapiens GN=RFT1 PE=1 SV=1 113 356 6.0E-22
sp|Q8C3B8|RFT1_MOUSE Protein RFT1 homolog OS=Mus musculus GN=Rft1 PE=2 SV=2 114 356 1.0E-20
sp|Q9Y123|RFT1_DROME Protein RFT1 homolog OS=Drosophila melanogaster GN=CG3149 PE=2 SV=1 131 379 2.0E-17
sp|Q0D2E8|RFT1_XENTR Protein RFT1 homolog OS=Xenopus tropicalis GN=rft1 PE=2 SV=1 113 377 2.0E-17
sp|Q23444|RFT1_CAEEL Protein RFT1 homolog OS=Caenorhabditis elegans GN=ZK180.3 PE=3 SV=1 113 359 1.0E-16
sp|Q54IV7|RFT1_DICDI Protein RFT1 homolog OS=Dictyostelium discoideum GN=rft1 PE=3 SV=1 114 336 4.0E-16
sp|Q5A6N8|RFT1_CANAL Oligosaccharide translocation protein RFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFT1 PE=3 SV=1 4 99 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0044237 cellular metabolic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0005575 cellular_component No
GO:1901576 organic substance biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0006629 lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0008152 metabolic process No
GO:0031224 intrinsic component of membrane No
GO:1901135 carbohydrate derivative metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 151 173 22
3 230 252 22
4 267 289 22
5 301 323 22
6 327 346 19
7 358 380 22
8 395 413 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4185
MPPPAKSRLRGASLLITLQLTSRLLSFTANQLFLLRHVTATQLGHAARLEASAATVLFLARDGLRVAVPRVRQPE
PQSVVNLGYLSAALAYALTLLTVYTLTLYRLSSVLNFSLLPRASSAGYLDGPAVRLAASVSAQGIVKHLLTQGDT
FLVAVLAPAHVQGVYALANNYGGLLARLLFQPIEESCRGYFSLLLSPEQQSATGKDDGEGTKKVVAVVEASRSLT
VLARLYLVLSVIVVALGPFAAPPLLALVAGSRWSEAGAGRVLATYSLYVPFLALNGLAEAFVASVATERHLHRQS
LAMAVFSLVFAVSAGVLMRVLGWGAHGLVVANMVNLLCRICWCAVFIKDYFGRRKHAFSLTALFPRHAFAAAAAV
AAVLVRLRVHDGAESEPIRALAMIAAWAIPLLAITAFLERDLLLQCLHSVRGKEVGKP*
Coding >Ophun1|4185
ATGCCCCCCCCAGCCAAATCCCGTCTACGAGGCGCCTCCCTCCTCATAACCCTCCAGCTAACCTCTCGCCTCCTC
TCCTTCACCGCAAACCAACTCTTCCTCCTCCGCCACGTAACCGCCACCCAACTCGGCCACGCCGCCCGTCTCGAA
GCCTCGGCGGCAACCGTCCTCTTCCTCGCCCGCGATGGCCTCCGCGTCGCCGTCCCGCGCGTCCGCCAGCCGGAG
CCGCAGTCCGTCGTGAACCTCGGGTACCTCTCCGCCGCGCTCGCCTACGCACTCACCCTCCTCACCGTCTACACC
CTCACCCTCTACCGCCTATCCTCAGTCCTCAACTTCTCGCTCCTGCCGCGGGCCTCGTCGGCGGGATACCTTGAC
GGACCTGCCGTGCGACTGGCGGCCTCTGTTTCGGCGCAGGGGATTGTCAAGCATCTTCTCACGCAGGGGGATACC
TTTCTCGTTGCGGTTTTGGCGCCGGCTCATGTCCAGGGGGTTTATGCGCTGGCGAATAACTATGGGGGCTTGCTG
GCTCGTCTGCTCTTTCAACCCATCGAAGAGTCCTGTCGCGGCTACTTTTCGCTTCTGCTTTCGCCGGAGCAGCAG
TCCGCGACGGGGAAAGATGATGGCGAGGGAACCAAAAAGGTCGTCGCAGTCGTCGAAGCAAGTCGCAGCCTCACC
GTCCTCGCAAGACTCTACCTCGTTCTCTCCGTCATCGTCGTCGCCCTCGGCCCCTTTGCCGCCCCGCCGCTGCTG
GCTCTCGTGGCCGGTAGTCGCTGGTCTGAGGCTGGGGCTGGCCGCGTGCTCGCTACCTATAGCCTCTACGTGCCC
TTCCTGGCTCTCAACGGCCTGGCTGAGGCTTTCGTCGCCTCGGTTGCTACTGAGCGTCATCTTCACCGTCAGTCT
TTGGCAATGGCAGTCTTTAGCCTTGTCTTTGCTGTCTCTGCTGGTGTTCTTATGCGCGTCTTGGGCTGGGGTGCT
CATGGGCTTGTCGTCGCTAATATGGTTAACCTGCTGTGTCGCATCTGCTGGTGCGCCGTCTTCATCAAGGACTAT
TTTGGTCGTCGGAAGCACGCCTTTTCCCTGACGGCTTTGTTTCCTCGTCACGCATTTGCCGCAGCCGCTGCAGTT
GCTGCTGTTCTCGTCCGCTTGCGTGTTCACGATGGCGCAGAGTCTGAGCCGATTCGAGCTCTTGCCATGATTGCT
GCCTGGGCAATCCCTTTGCTCGCCATTACAGCCTTCTTGGAGAGAGACTTGCTGCTTCAATGTCTGCACTCCGTC
CGCGGCAAAGAGGTTGGCAAGCCCTGA
Transcript >Ophun1|4185
ATGCCCCCCCCAGCCAAATCCCGTCTACGAGGCGCCTCCCTCCTCATAACCCTCCAGCTAACCTCTCGCCTCCTC
TCCTTCACCGCAAACCAACTCTTCCTCCTCCGCCACGTAACCGCCACCCAACTCGGCCACGCCGCCCGTCTCGAA
GCCTCGGCGGCAACCGTCCTCTTCCTCGCCCGCGATGGCCTCCGCGTCGCCGTCCCGCGCGTCCGCCAGCCGGAG
CCGCAGTCCGTCGTGAACCTCGGGTACCTCTCCGCCGCGCTCGCCTACGCACTCACCCTCCTCACCGTCTACACC
CTCACCCTCTACCGCCTATCCTCAGTCCTCAACTTCTCGCTCCTGCCGCGGGCCTCGTCGGCGGGATACCTTGAC
GGACCTGCCGTGCGACTGGCGGCCTCTGTTTCGGCGCAGGGGATTGTCAAGCATCTTCTCACGCAGGGGGATACC
TTTCTCGTTGCGGTTTTGGCGCCGGCTCATGTCCAGGGGGTTTATGCGCTGGCGAATAACTATGGGGGCTTGCTG
GCTCGTCTGCTCTTTCAACCCATCGAAGAGTCCTGTCGCGGCTACTTTTCGCTTCTGCTTTCGCCGGAGCAGCAG
TCCGCGACGGGGAAAGATGATGGCGAGGGAACCAAAAAGGTCGTCGCAGTCGTCGAAGCAAGTCGCAGCCTCACC
GTCCTCGCAAGACTCTACCTCGTTCTCTCCGTCATCGTCGTCGCCCTCGGCCCCTTTGCCGCCCCGCCGCTGCTG
GCTCTCGTGGCCGGTAGTCGCTGGTCTGAGGCTGGGGCTGGCCGCGTGCTCGCTACCTATAGCCTCTACGTGCCC
TTCCTGGCTCTCAACGGCCTGGCTGAGGCTTTCGTCGCCTCGGTTGCTACTGAGCGTCATCTTCACCGTCAGTCT
TTGGCAATGGCAGTCTTTAGCCTTGTCTTTGCTGTCTCTGCTGGTGTTCTTATGCGCGTCTTGGGCTGGGGTGCT
CATGGGCTTGTCGTCGCTAATATGGTTAACCTGCTGTGTCGCATCTGCTGGTGCGCCGTCTTCATCAAGGACTAT
TTTGGTCGTCGGAAGCACGCCTTTTCCCTGACGGCTTTGTTTCCTCGTCACGCATTTGCCGCAGCCGCTGCAGTT
GCTGCTGTTCTCGTCCGCTTGCGTGTTCACGATGGCGCAGAGTCTGAGCCGATTCGAGCTCTTGCCATGATTGCT
GCCTGGGCAATCCCTTTGCTCGCCATTACAGCCTTCTTGGAGAGAGACTTGCTGCTTCAATGTCTGCACTCCGTC
CGCGGCAAAGAGGTTGGCAAGCCCTGA
Gene >Ophun1|4185
ATGCCCCCCCCAGCCAAATCCCGTCTACGAGGCGCCTCCCTCCTCATAACCCTCCAGCTAACCTCTCGCCTCCTC
TCCTTCACCGCAAACCAACTCTTCCTCCTCCGCCACGTAACCGCCACCCAACTCGGCCACGCCGCCCGTCTCGAA
GCCTCGGCGGCAACCGTCCTCTTCCTCGCCCGCGATGGCCTCCGCGTCGCCGTCCCGCGCGTCCGCCAGCCGGAG
CCGCAGTCCGTCGTGAACCTCGGGTACCTCTCCGCCGCGGTGGGCGCCGTCGTGCTGGCTGTTGGCTTGCTGGGC
TGGGGGGTTGGGGAGGGGGGTGCCAGGGGGGTTTATGGGCTGGCGGTGGCAGGGGAGTTGTTGGCTGAGCCGGCG
TTCTTGCTGCTGCTGGTGAGGGGGAGGGTCGGGGCGCGGGCTGTTGCTGAGTCCGGGGGGGTGTTGGCTCGCTGT
GTCGTCCTCTTCCTTGCTGTTCGCTCTTGGGCGGATGGGGGACTTGGGCATCAGGTCTTGCCCTTTGCTCTCGGA
CAGCTCGCCTACGCACTCACCCTCCTCACCGTCTACACCCTCACCCTCTACCGCCTATCCTCAGTCCTCAACTTC
TCGCTCCTGCCGCGGGCCTCGTCGGCGGGATACCTTGACGGACCTGCCGTGCGACTGGCGGCCTCTGTTTCGGCG
CAGGGGATTGTCAAGCATCTTCTCACGCAGGGGGATACCTTTCTCGTTGCGGTTTTGGCGCCGGCTCATGTCCAG
GGGGTTTATGCGCTGGCGAATAACTATGGGGGCTTGCTGGCTCGTCTGCTCTTTCAACCCATCGAAGAGTCCTGT
CGCGGCTACTTTTCGCTTCTGCTTTCGCCGGAGCAGCAGTCCGCGACGGGGAAAGATGATGGCGAGGGAACCAAA
AAGGTCGTCGCAGTCGTCGAAGCAAGTCGCAGCCTCACCGTCCTCGCAAGACTCTACCTCGTTCTCTCCGTCATC
GTCGTCGCCCTCGGCCCCTTTGCCGCCCCGCCGCTGCTGGCTCTCGTGGCCGGTAGTCGCTGGTCTGAGGCTGGG
GCTGGCCGCGTGCTCGCTACCTATAGCCTCTACGTGCCCTTCCTGGCTCTCAACGGCCTGGCTGAGGCTTTCGTC
GCCTCGGTTGCTACTGAGCGTCATCTTCACCGTCAGTCTTTGGCAATGGCAGTCTTTAGCCTTGTCTTTGCTGTC
TCTGCTGGTGTTCTTATGCGCGTCTTGGGCTGGGGTGCTCATGGGCTTGTCGTCGCTAATATGGTTAACCTGCTG
TGTCGCATCTGCTGGTGCGCCGTCTTCATCAAGGACTATTTTGGTCGTCGGAAGCACGCCTTTTCCCTGACGGCT
TTGTTTCCTCGTCACGCATTTGCCGCAGCCGCTGCAGTTGCTGCTGTTCTCGTCCGCTTGCGTGTTCACGATGGC
GCAGAGTCTGAGCCGATTCGAGCTCTTGCCATGATTGCTGCCTGGGCAATCCCTTTGCTCGCCATTACGTACGTT
CATTCTTCTCTTCTTCTATATCTTGTGGTTTGAACACCAATTTTACCGACGTGAAACTGACAAAAGCCTTGAGCA
GAGCCTTCTTGGAGAGAGACTTGCTGCTTCAATGTCTGCACTCCGTCCGCGGCAAAGAGGTTGGCAAGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail