Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4178
Gene name
LocationContig_383:6318..9391
Strand+
Gene length (bp)3073
Transcript length (bp)2412
Coding sequence length (bp)2412
Protein length (aa) 804

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00023 Ank Ankyrin repeat 3.2E-04 679 717
PF00023 Ank Ankyrin repeat 2.7E-04 720 750
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.4E-08 665 750
PF13857 Ank_5 Ankyrin repeats (many copies) 9.9E-09 706 760
PF13637 Ank_4 Ankyrin repeats (many copies) 5.1E-06 703 732
PF13606 Ank_3 Ankyrin repeat 1.3E-03 720 747
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 9.6E-05 110 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46088|GST_NOTSL Glutathione S-transferase OS=Nototodarus sloanii PE=1 SV=1 14 173 3.0E-11
sp|P91252|GST6_CAEEL Probable glutathione S-transferase 6 OS=Caenorhabditis elegans GN=gst-6 PE=3 SV=2 15 167 8.0E-09
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 600 763 1.0E-08
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 600 763 1.0E-08
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 491 755 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46088|GST_NOTSL Glutathione S-transferase OS=Nototodarus sloanii PE=1 SV=1 14 173 3.0E-11
sp|P91252|GST6_CAEEL Probable glutathione S-transferase 6 OS=Caenorhabditis elegans GN=gst-6 PE=3 SV=2 15 167 8.0E-09
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 600 763 1.0E-08
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 600 763 1.0E-08
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 491 755 3.0E-08
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 474 755 5.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 660 761 6.0E-08
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 448 755 9.0E-08
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 664 781 1.0E-07
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 661 755 1.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 660 761 2.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 660 796 2.0E-07
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 660 796 2.0E-07
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 660 796 2.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 664 760 3.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 660 796 3.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 660 796 3.0E-07
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 660 796 4.0E-07
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 665 753 4.0E-07
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 660 762 6.0E-07
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 660 796 9.0E-07
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 660 796 9.0E-07
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 665 760 1.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 658 791 3.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 660 771 3.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 665 760 3.0E-06
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 676 760 3.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 665 760 4.0E-06
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 665 760 4.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 665 757 6.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 660 772 6.0E-06
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 659 757 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4178
MPPNNPPLSSSTLTLRYFPLRWRAEGARFILLATHAPFTDETPSWPSAQTQQPLSQLPVLIERTPDSSSDYLLSD
SVAIEYYLARRAGLVVDSGLRDSAREMELRNQMEDLHIRLAIYIYGAEAGREMAADRFMRLAKSFVDYHEGVLAR
NGSNGHYFGSRTTYVDISLYLLLLLIRRRHEVDLPGREDVFSKDKAPGINRVYRAVKEDALSRPIIIIVIMQPAT
RPSPPAFIKPLPSPPPTITHRIMASSPAPSAGRPSLWTRSAERKMTRLYVYTTLPLETIVRVVHWRDPESSPGID
SANRKLRSLLDKEPRWLHPRDESDMCRRLAELSNSPTRTNNDSPSSPISSGSDNSRPGPPSVFPPRVPSGDGSVF
IPFLRQTTWLSTSTDCSTGSFRDRLPQYSRPLNRHCLCRDHMDDVISPWLVPEGITTLGHAISESGPTSLEHLTA
RDSVGNTLLHFIAARCRLDLLSAMLRSGCCQRLLRESNAGGQTFLLVIASTHLRDASRFLEFLILATACGADVHA
RDVYGRSVFHMLRLARHGPETIRRIALHFPGPAPDSRDAFGLVPTASDPIYHLGPVISSSAPEPDLTIQSHNLHI
ISRSLDNPSFQDIHGRNALHILATTSLSPASIALRLTNHKRHHPTHQLDSSRPRLQLRHELLLGLLQAGVPPNHY
DSAGETPLMAFAAHLPEDDDYKMGPLIIDLLIRHGADVNARNRAGETALHVAVRHGRKLAIRSLVRHGASVHARD
ARGRSLLDVADAIMAACVSGSQYAHYEACRAWLSGDEGKAIQRPGLLDEWGFA*
Coding >Ophun1|4178
ATGCCCCCCAACAACCCCCCCCTATCCTCCTCTACCTTAACCCTCCGCTACTTCCCCCTCCGCTGGCGCGCCGAA
GGAGCCCGCTTCATCCTCCTAGCAACCCACGCCCCCTTCACCGACGAAACGCCCTCCTGGCCCTCAGCACAAACC
CAGCAACCCCTCTCACAACTCCCCGTCCTCATCGAGCGAACCCCCGACTCCAGCTCCGACTATCTCCTCTCCGAC
TCGGTGGCTATAGAGTATTACCTCGCCAGGCGGGCAGGCCTCGTCGTCGACTCGGGACTGCGCGACTCGGCGCGC
GAGATGGAGCTGCGCAACCAGATGGAGGATCTACATATCCGACTGGCTATCTACATCTACGGCGCGGAGGCGGGT
CGCGAAATGGCGGCTGATAGGTTCATGCGTCTGGCTAAGAGCTTCGTCGACTACCACGAAGGGGTGCTGGCGCGG
AATGGGTCCAATGGGCATTACTTTGGCAGCCGGACGACGTACGTCGACATTAGTCTGTACCTGCTGCTGCTTCTG
ATCCGTCGTCGGCACGAGGTTGATCTTCCGGGACGGGAAGACGTGTTTTCTAAGGATAAGGCGCCGGGCATCAAC
CGCGTGTATCGAGCTGTCAAGGAGGATGCTCTGTCACGGCCCATCATAATCATCGTCATCATGCAGCCCGCCACT
CGTCCATCGCCTCCGGCGTTTATAAAGCCGCTTCCCAGTCCGCCCCCGACGATCACGCACCGGATCATGGCGTCT
TCTCCGGCTCCCTCCGCCGGCCGGCCCTCGTTATGGACCCGGTCAGCGGAGCGTAAAATGACGCGGCTGTATGTT
TACACGACGCTTCCGCTCGAGACTATCGTCAGGGTGGTTCACTGGCGAGATCCCGAGTCTAGTCCTGGCATCGAC
TCCGCCAACAGAAAACTCCGCTCCCTCCTCGACAAAGAACCACGATGGCTTCACCCCCGCGACGAATCCGACATG
TGCCGCCGCCTCGCCGAACTCTCCAACTCACCCACCCGAACAAACAACGACTCCCCCTCCAGCCCCATCTCCTCC
GGCTCAGACAACTCCCGCCCCGGCCCCCCCTCCGTCTTCCCCCCTCGGGTCCCCTCCGGCGATGGCTCCGTCTTC
ATCCCTTTTCTCCGGCAGACGACTTGGCTCTCTACCTCGACGGATTGCTCGACGGGCTCGTTCCGCGATAGACTA
CCGCAGTACTCGAGACCTCTCAACCGCCACTGCCTCTGCCGCGACCACATGGACGACGTCATCTCCCCCTGGCTC
GTCCCCGAAGGCATCACCACCCTCGGCCACGCCATCAGCGAATCCGGCCCAACCAGCCTCGAGCATCTCACCGCC
CGCGACTCCGTCGGCAACACGCTCCTTCACTTCATCGCCGCCCGCTGCCGTCTCGACCTGCTCTCTGCCATGCTC
CGCTCCGGCTGCTGTCAGCGTCTGCTGCGGGAGAGCAACGCCGGCGGTCAGACGTTTCTGCTTGTCATTGCTAGC
ACTCACCTGCGAGACGCCTCTCGCTTCCTTGAGTTCCTCATCCTAGCTACGGCATGCGGCGCCGATGTCCATGCC
CGAGACGTATACGGCCGCTCCGTCTTTCACATGCTCCGTCTCGCCCGTCACGGCCCGGAGACGATCCGCCGGATA
GCCCTTCACTTCCCCGGCCCGGCCCCCGACAGCCGCGACGCCTTCGGACTCGTCCCCACCGCCTCCGACCCGATA
TACCATCTCGGCCCGGTCATATCATCATCCGCCCCGGAGCCCGACCTAACCATCCAGAGCCACAACCTACACATC
ATCTCCCGCTCCCTAGACAACCCATCCTTCCAAGACATCCACGGCCGCAACGCCCTCCACATCCTCGCCACCACC
TCCCTCAGCCCCGCCAGCATCGCCCTCCGCCTCACCAACCACAAGAGACACCATCCAACCCACCAGCTCGACTCC
AGCCGCCCCCGTCTCCAACTCCGCCACGAACTCCTCCTCGGCCTCCTCCAAGCCGGCGTCCCCCCCAACCACTAC
GACTCGGCCGGAGAAACCCCCCTGATGGCCTTCGCCGCCCACCTCCCCGAAGACGACGACTACAAGATGGGCCCC
CTCATAATCGACCTCCTCATCCGCCACGGCGCCGACGTAAACGCCCGCAACCGAGCCGGAGAAACAGCCCTCCAC
GTCGCCGTCCGTCACGGCCGTAAGCTCGCCATCCGCTCCCTCGTCCGCCATGGAGCCAGCGTCCACGCTCGCGAC
GCCCGTGGACGGAGCCTGCTCGATGTCGCTGATGCTATCATGGCCGCCTGCGTCAGCGGAAGCCAGTACGCTCAT
TACGAGGCTTGTCGCGCCTGGCTGAGCGGTGACGAGGGCAAGGCCATCCAGAGGCCAGGCCTGCTAGACGAGTGG
GGGTTTGCGTGA
Transcript >Ophun1|4178
ATGCCCCCCAACAACCCCCCCCTATCCTCCTCTACCTTAACCCTCCGCTACTTCCCCCTCCGCTGGCGCGCCGAA
GGAGCCCGCTTCATCCTCCTAGCAACCCACGCCCCCTTCACCGACGAAACGCCCTCCTGGCCCTCAGCACAAACC
CAGCAACCCCTCTCACAACTCCCCGTCCTCATCGAGCGAACCCCCGACTCCAGCTCCGACTATCTCCTCTCCGAC
TCGGTGGCTATAGAGTATTACCTCGCCAGGCGGGCAGGCCTCGTCGTCGACTCGGGACTGCGCGACTCGGCGCGC
GAGATGGAGCTGCGCAACCAGATGGAGGATCTACATATCCGACTGGCTATCTACATCTACGGCGCGGAGGCGGGT
CGCGAAATGGCGGCTGATAGGTTCATGCGTCTGGCTAAGAGCTTCGTCGACTACCACGAAGGGGTGCTGGCGCGG
AATGGGTCCAATGGGCATTACTTTGGCAGCCGGACGACGTACGTCGACATTAGTCTGTACCTGCTGCTGCTTCTG
ATCCGTCGTCGGCACGAGGTTGATCTTCCGGGACGGGAAGACGTGTTTTCTAAGGATAAGGCGCCGGGCATCAAC
CGCGTGTATCGAGCTGTCAAGGAGGATGCTCTGTCACGGCCCATCATAATCATCGTCATCATGCAGCCCGCCACT
CGTCCATCGCCTCCGGCGTTTATAAAGCCGCTTCCCAGTCCGCCCCCGACGATCACGCACCGGATCATGGCGTCT
TCTCCGGCTCCCTCCGCCGGCCGGCCCTCGTTATGGACCCGGTCAGCGGAGCGTAAAATGACGCGGCTGTATGTT
TACACGACGCTTCCGCTCGAGACTATCGTCAGGGTGGTTCACTGGCGAGATCCCGAGTCTAGTCCTGGCATCGAC
TCCGCCAACAGAAAACTCCGCTCCCTCCTCGACAAAGAACCACGATGGCTTCACCCCCGCGACGAATCCGACATG
TGCCGCCGCCTCGCCGAACTCTCCAACTCACCCACCCGAACAAACAACGACTCCCCCTCCAGCCCCATCTCCTCC
GGCTCAGACAACTCCCGCCCCGGCCCCCCCTCCGTCTTCCCCCCTCGGGTCCCCTCCGGCGATGGCTCCGTCTTC
ATCCCTTTTCTCCGGCAGACGACTTGGCTCTCTACCTCGACGGATTGCTCGACGGGCTCGTTCCGCGATAGACTA
CCGCAGTACTCGAGACCTCTCAACCGCCACTGCCTCTGCCGCGACCACATGGACGACGTCATCTCCCCCTGGCTC
GTCCCCGAAGGCATCACCACCCTCGGCCACGCCATCAGCGAATCCGGCCCAACCAGCCTCGAGCATCTCACCGCC
CGCGACTCCGTCGGCAACACGCTCCTTCACTTCATCGCCGCCCGCTGCCGTCTCGACCTGCTCTCTGCCATGCTC
CGCTCCGGCTGCTGTCAGCGTCTGCTGCGGGAGAGCAACGCCGGCGGTCAGACGTTTCTGCTTGTCATTGCTAGC
ACTCACCTGCGAGACGCCTCTCGCTTCCTTGAGTTCCTCATCCTAGCTACGGCATGCGGCGCCGATGTCCATGCC
CGAGACGTATACGGCCGCTCCGTCTTTCACATGCTCCGTCTCGCCCGTCACGGCCCGGAGACGATCCGCCGGATA
GCCCTTCACTTCCCCGGCCCGGCCCCCGACAGCCGCGACGCCTTCGGACTCGTCCCCACCGCCTCCGACCCGATA
TACCATCTCGGCCCGGTCATATCATCATCCGCCCCGGAGCCCGACCTAACCATCCAGAGCCACAACCTACACATC
ATCTCCCGCTCCCTAGACAACCCATCCTTCCAAGACATCCACGGCCGCAACGCCCTCCACATCCTCGCCACCACC
TCCCTCAGCCCCGCCAGCATCGCCCTCCGCCTCACCAACCACAAGAGACACCATCCAACCCACCAGCTCGACTCC
AGCCGCCCCCGTCTCCAACTCCGCCACGAACTCCTCCTCGGCCTCCTCCAAGCCGGCGTCCCCCCCAACCACTAC
GACTCGGCCGGAGAAACCCCCCTGATGGCCTTCGCCGCCCACCTCCCCGAAGACGACGACTACAAGATGGGCCCC
CTCATAATCGACCTCCTCATCCGCCACGGCGCCGACGTAAACGCCCGCAACCGAGCCGGAGAAACAGCCCTCCAC
GTCGCCGTCCGTCACGGCCGTAAGCTCGCCATCCGCTCCCTCGTCCGCCATGGAGCCAGCGTCCACGCTCGCGAC
GCCCGTGGACGGAGCCTGCTCGATGTCGCTGATGCTATCATGGCCGCCTGCGTCAGCGGAAGCCAGTACGCTCAT
TACGAGGCTTGTCGCGCCTGGCTGAGCGGTGACGAGGGCAAGGCCATCCAGAGGCCAGGCCTGCTAGACGAGTGG
GGGTTTGCGTGA
Gene >Ophun1|4178
ATGCCCCCCAACAACCCCCCCCTATCCTCCTCTACCTTAACCCTCCGCTACTTCCCCCTCCGCTGGCGCGCCGAA
GGAGCCCGCTTCATCCTCCTAGCAACCCACGCCCCCTTCACCGACGAAACGCCCTCCTGGCCCTCAGCACAAACC
CAGCAACCCCTCTCACAACTCCCCGTCCTCATCGAGCGAACCCCCGACTCCAGCTCCGACTATCTCCTCTCCGAC
TCGGTGGCTATAGAGTATTACCTCGCCAGGCGGGCAGGCCTCGTCGTCGACTCGGGACTGCGCGACTCGGCGCGC
GAGATGGAGCTGCGCAACCAGATGGAGGATCTACATATCCGACTGGCTATCTACATCTACGGCGCGGAGGCGGGT
CGCGAAATGGCGGCTGATAGGTTCATGCGTCTGGCTAAGAGCTTCGTCGACTACCACGAAGGGGTGCTGGCGCGG
AATGGGTCCAATGGGCATTACTTTGGCAGCCGGACGACGTACGTCGACATTAGTCTGTACCTGCTGCTGCTTCTG
ATCCGTCGTCGGCACGAGGTTGATCTTCCGGGACGGGAAGACGTGTTTTCTAAGGATAAGGCGCCGGGCATCAAC
CGCGTGTATCGAGCTGTCAAGGAGGATGCTCTGTCACGGCCGTACGTTGCCTGGTTAGAGAAGGACGACGAAGAT
GTTGCTGCTCGGTTGGCGTCGTTTGAGTGAAGGGTTCATGTCGGTAGTATACAGTATTCTACTGGCTTGACCTCG
ACAAGACCAAGAATCTAATGCATCAATTCGTACGTACATGTATTCGTACACTTCCAGATCGTCAGCCACCGAATA
AGCAAACAATCTGCAAAGCCTCGGACCAAGCAACCAACGAAGCATCAAAGCATCCATCCAACCCATCCATCATAG
AGCCAAGCCCGCAGCAGAGGCGCAGCCAAACAAGACTCCAGCTCCGAAGCCAGACCCCAGCAAGCCAACCATCAC
TAACAGCATCATAATCATCGTCATCATGCAGCCCGCCACTCGTCCATCGCCTCCGGCGTTTATAAAGCCGCTTCC
CAGTCCGCCCCCGACGATCACGCACCGGATCATGGCGTCTTCTCCGGCTCCCTCCGCCGGCCGGCCCTCGTTATG
GACCCGGTCAGCGGAGCGTAAAATGACGCGGCTGTATGTTTACACGACGCTTCCGCTCGAGACTATCGTCAGGGT
GGTTCACTGGCGAGATCCCGAGTCTAGTCCTGGGTATGGAGATGATTTTCATCTCTCCCTCTTTCTACTTCTCTC
TCTCTCTTTCTTCATCTCCCCCTCTCCCCCCATCTCCCCCTCTCTACATCCTCACATATATACAAACTGAAAAAC
CCCCAGCATCGACTCCGCCAACAGAAAACTCCGCTCCCTCCTCGACAAAGAACCACGATGGCTTCACCCCCGCGA
CGAATCCGACATGTGCCGCCGCCTCGCCGAACTCTCCAACTCACCCACCCGAACAAACAACGACTCCCCCTCCAG
CCCCATCTCCTCCGGCTCAGACAACTCCCGCCCCGGCCCCCCCTCCGTCTTCCCCCCTCGGGTCCCCTCCGGCGA
TGGCTCCGTCTTCATCCCTTTTCTCCGGCAGACGACTTGGCTCTCTACCTCGACGGATTGCTCGACGGGCTCGTT
CCGCGATAGACTACCGCAGTACTCGAGACCGTACGTCCAGGCAGTGAAGAGGCTACTCAAGCGCTTCACCGTCCC
GATCCGATCCCCATCCCCATCCTCAGATCCTCACACAGATGATCCCCCCCTTATATCAACACACGCCATGTTCTG
TGACGCCTACCCTCTCCCAGGCCACCTCCTCTACCGCGACCTCTTCATGTGCGCATGCCACTCCCTCCCCCCCTC
CAGTCTCAACCGCCACTGCCTCTGCCGCGACCACATGGACGACGTCATCTCCCCCTGGCTCGTCCCCGAAGGCAT
CACCACCCTCGGCCACGCCATCAGCGAATCCGGCCCAACCAGCCTCGAGCATCTCACCGCCCGCGACTCCGTCGG
CAACACGCTCCTTCACTTCATCGCCGCCCGCTGCCGTCTCGACCTGCTCTCTGCCATGCTCCGCTCCGGCTGCTG
TCAGCGTCTGCTGCGGGAGAGCAACGCCGGCGGTCAGACGTTTCTGCTTGTCATTGCTAGCACTCACCTGCGAGA
CGCCTCTCGCTTCCTTGAGTTCCTCATCCTAGCTACGGCATGCGGCGCCGATGTCCATGCCCGAGACGTATACGG
CCGCTCCGTCTTTCACATGCTCCGTCTCGCCCGTCACGGCCCGGAGACGATCCGCCGGATAGCCCTTCACTTCCC
CGGCCCGGCCCCCGACAGCCGCGACGCCTTCGGACTCGTCCCCACCGCCTCCGACCCGATATACCATCTCGGCCC
GGTCATATCATCATCCGCCCCGGAGCCCGACCTAACCATCCAGAGCCACAACCTACACATCATCTCCCGCTCCCT
AGACAACCCATCCTTCCAAGACATCCACGGCCGCAACGCCCTCCACATCCTCGCCACCACCTCCCTCAGCCCCGC
CAGCATCGCCCTCCGCCTCACCAACCACAAGAGACACCATCCAACCCACCAGCTCGACTCCAGCCGCCCCCGTCT
CCAACTCCGCCACGAACTCCTCCTCGGCCTCCTCCAAGCCGGCGTCCCCCCCAACCACTACGACTCGGCCGGAGA
AACCCCCCTGATGGCCTTCGCCGCCCACCTCCCCGAAGACGACGACTACAAGATGGGCCCCCTCATAATCGACCT
CCTCATCCGCCACGGCGCCGACGTAAACGCCCGCAACCGAGCCGGAGAAACAGCCCTCCACGTCGCCGTCCGTCA
CGGCCGTAAGCTCGCCATCCGCTCCCTCGTCCGCCATGGAGCCAGCGTCCACGCTCGCGACGCCCGTGGACGGAG
CCTGCTCGATGTCGCTGATGCTATCATGGCCGCCTGCGTCAGCGGAAGCCAGTACGCTCATTACGAGGCTTGTCG
CGCCTGGCTGAGCGGTGACGAGGGCAAGGCCATCCAGAGGCCAGGCCTGCTAGACGAGTGGGGGTTTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail