Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4177
Gene name
LocationContig_383:40..5406
Strand+
Gene length (bp)5366
Transcript length (bp)5052
Coding sequence length (bp)5052
Protein length (aa) 1684

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 45 67 22
3 82 104 22
4 125 147 22
5 157 179 22
6 200 222 22
7 292 314 22
8 335 357 22
9 362 384 22
10 405 427 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4177
MSTSAAMGTTTAFPSATLAFPTTAGKTRASRLRMDLPSEDLTRSLALAAALGVTGLALTLGLTGLALTLGFTGPA
GARGFKALALVLALMALALTLTLGLAPAPGFVAPALTLTLDLTSTLGFTGLTLISTLNLTLILGLMGLAAVLGFM
GLDAGLGFRGLALELALAPVFGFMALVLIRTTHQASALVLTGLAPTPTSTLTLTLGLMAIVAGSGFMGLATAQHV
NDPEPALELTDLSPDLDFMGLAPTLTLTLTLMDLAPVSGFMGLATAQRVNVPEPALEFTDLSPDLGFIGLATTLT
PTLTLTLMDLVSVFMALATAQRAMRQVPASNFRGLLPVLGFTALSLPPTLMILTSTLGWMILPLALGFMGLATAL
CIIELAPALDFMHLALPLSLASTLTRTRTLTLASAVAPAVAVFPLLNTAWHGSGFTSHTMSRSGRGSDDDLDDDF
GLGIGEGSRRGTGRGFGIGHGSGRGSNMDADFGEGFGIGHGSGRGSGRGFGEGFGFGEGSGEGSGEGSGRDSGRD
SGRGIGQGSGRVSDMDADFGEGFGIREGSGRGSGRGSGKSFGIGEDSGEGDGSGSAPGSRSSFTSQSFGLPDTTQ
LLPGLSNLLPDWLRPFRSPDSQASSVTPASFDALAPPSGIRFPRPPGFQVPNQGSSASTSGFTAPASGPSSAPKN
AFGSNDRPSVSMGVSFPSVSATPSASSSSANNPDDATPSASEPEKSTSDLSATASSQPDSSVPSLLDYPLISLRH
PDGNSSLLSLASSLGLDKPWNSVRLPTGSSSADRSDIPNGPDSPSDDPGVPSISLFPSGTNPTSLQPDSTPTQAA
MSAARPPKETRGSSPGVIPFARRPEQPSPRQPERPPFSYSPPPSFNRSGYPSPGRPLPKEPWSPFPGESEKPHGR
KSLKKWMGLKNWMGLKIWMSPTFRSPESLEDWASPGVRSPESIDDRVSLKGRMSPGFRSPTSPRGRASLGVRFPA
NLRDSMSLGHIGLVQPDVRSTASMRGTVRPFLRSPTARHLASPDIFPTAGRQPGPHPLFPASLDGRARPDVRTLA
STRDRVSLGLRSLSSLIGRVRLDVRSTASMRDRMRPDLRSPTARQLASPDIPSTVGHQQGPVTLSPVRVIGWARP
DVRFMASLDGRARPDVRIPARMRGRVVSDLRSIPVRQPASPDILSPADRHPGQNTRLPASTRDTASLRGRKSLKG
RASPVILSPASMRGMASMRDMASMRGMVSLEDWVSPDTHSPESMRSTASMRGPVSPDTRSPASMRDMHGEHERPG
EPGHPFLGEHERPGEPGRPHKPGFPFPGEHENPFPGEHEKQGEHEYPFPGEHHSHDEPERQREPGFPLPGEPQNP
FHGEHERHGEHEYPFPGQHQKHGEPGSPSPGEHERHGEPGFPFPGESGKPREPWFPLPSEPKPPFPRETNPSSPW
DEEEPSESEPALPTPPSVRFPLPAGPEPTAMLEKLPHYPDDTLWTTSTIWTTSVHTVTHCPAQVEDCPAHKAHTM
VVTRTIALSTTVCPVEYAGQQPTKFPLPPGPYKQPSDREPPSPSEPFHPSHLKFPIDAPFRPEPRIGIPFGTGVP
RLHRPDTMFPGPDSPPVVAERIPIPGPGFGPLPSAERGAAPRTEWQEEPEPTTLALKARPSAGWPAAALEEAQAA
MSSPVVTAAAGRVSNRVYKTIACVGVVGLMAVL*
Coding >Ophun1|4177
ATGTCGACTTCGGCGGCTATGGGGACGACGACGGCTTTCCCTTCAGCGACATTGGCCTTTCCGACGACCGCTGGC
AAGACTCGGGCTTCCCGACTGCGGATGGACCTCCCTTCGGAGGACCTGACGCGATCTCTCGCTCTGGCCGCGGCG
TTGGGCGTCACAGGTCTGGCCTTGACCTTGGGCTTGACGGGGCTGGCCTTGACCTTGGGCTTCACAGGTCCGGCC
GGGGCAAGGGGCTTCAAGGCTCTGGCGCTGGTTTTGGCCTTGATGGCTCTGGCTCTGACCTTGACTTTGGGCCTG
GCACCGGCTCCGGGCTTCGTGGCTCCAGCCCTGACGCTGACTTTGGATCTGACCTCGACTTTGGGCTTCACAGGT
CTGACCCTGATTTCGACTCTGAACCTGACCTTGATCTTGGGTTTGATGGGTCTAGCCGCCGTGTTGGGGTTCATG
GGTCTGGACGCCGGGTTGGGCTTCAGGGGTCTGGCGCTGGAGTTGGCTCTGGCGCCGGTCTTCGGCTTCATGGCT
CTGGTTCTGATCAGGACAACACACCAGGCATCGGCTTTGGTTCTCACAGGGTTGGCTCCGACTCCGACTTCGACC
CTGACTTTGACCTTGGGCTTGATGGCAATAGTCGCAGGCTCGGGATTCATGGGTCTGGCTACGGCTCAGCACGTC
AACGATCCGGAGCCGGCGTTGGAGCTCACGGACCTGTCCCCCGACTTGGACTTCATGGGTCTGGCTCCGACCCTG
ACTTTGACCTTGACCTTGATGGATCTGGCCCCGGTCTCGGGATTCATGGGCCTGGCTACGGCTCAGCGCGTCAAC
GTTCCAGAGCCGGCGTTGGAGTTCACGGACCTGTCCCCCGACCTAGGCTTTATAGGCCTGGCTACGACGTTGACT
CCGACCCTGACTTTGACCTTGATGGATCTGGTCTCGGTATTCATGGCTCTGGCCACGGCTCAGCGCGCCATGCGC
CAGGTGCCGGCGTCAAACTTCAGGGGTCTGCTCCCGGTCTTGGGCTTCACGGCTCTGTCCCTACCCCCAACCTTG
ATGATACTGACCTCGACATTGGGCTGGATGATTCTACCCCTGGCCTTGGGGTTCATGGGTCTGGCCACGGCGCTA
TGCATCATAGAATTGGCGCCGGCGTTGGACTTCATGCATCTGGCTCTGCCCCTGAGTTTGGCTTCGACTCTGACT
CGGACCCGGACTTTGACATTGGCTTCGGCCGTGGCTCCGGCAGTGGCCGTGTTCCCGCTGCTAAACACAGCATGG
CATGGCTCCGGCTTCACCTCTCATACCATGTCCCGCAGTGGCCGTGGCTCCGACGACGACTTAGACGACGACTTT
GGCCTTGGCATTGGCGAGGGTTCCCGCAGGGGAACCGGCAGGGGCTTTGGCATCGGCCACGGCTCCGGCAGGGGC
TCGAACATGGACGCTGACTTTGGCGAGGGCTTCGGCATCGGCCACGGCTCGGGCAGGGGTTCCGGTAGGGGCTTT
GGCGAGGGCTTTGGCTTTGGCGAGGGCTCCGGCGAGGGCTCCGGCGAGGGCTCCGGCAGGGACTCCGGCAGGGAC
TCCGGCAGGGGCATTGGCCAGGGCTCCGGCAGGGTCTCAGACATGGACGCCGACTTCGGAGAGGGCTTCGGCATC
CGCGAGGGCTCCGGCAGGGGCTCCGGCAGGGGCTCCGGCAAGAGCTTCGGCATTGGCGAGGACTCCGGCGAGGGT
GATGGTTCTGGCTCCGCGCCTGGCTCTCGCTCCTCCTTCACCAGCCAGTCATTCGGGCTCCCCGACACAACTCAA
CTCCTTCCAGGGCTATCCAATTTGCTGCCAGACTGGCTACGTCCGTTTCGAAGCCCCGATTCTCAAGCGAGCTCT
GTTACCCCGGCCTCATTCGACGCCCTTGCGCCTCCGTCCGGGATCCGATTCCCCCGTCCTCCGGGATTCCAAGTT
CCCAACCAAGGTTCTTCCGCGTCCACGTCCGGCTTCACCGCCCCGGCTTCTGGGCCGTCAAGCGCGCCGAAGAAT
GCATTCGGATCCAACGACCGGCCGTCTGTCTCGATGGGCGTCTCGTTTCCTAGTGTATCTGCGACTCCGTCGGCA
TCGTCCTCTTCTGCTAACAACCCGGACGACGCAACCCCATCGGCCTCGGAGCCTGAAAAGTCAACATCCGACCTT
TCTGCAACTGCGTCGTCGCAGCCCGACTCGTCTGTCCCCAGCTTGTTGGACTATCCTCTCATCTCGCTTCGTCAT
CCGGACGGGAACTCATCGTTACTGTCGCTTGCATCGTCACTGGGGCTTGACAAGCCATGGAATAGCGTCCGTTTA
CCGACAGGCTCATCGTCTGCCGATCGTTCAGATATTCCAAACGGACCTGACTCGCCATCGGATGACCCCGGTGTC
CCGTCGATATCTCTGTTTCCTTCGGGCACAAACCCGACGTCTCTTCAGCCCGACTCGACCCCTACCCAGGCTGCT
ATGTCAGCCGCCAGACCGCCTAAAGAGACTCGAGGCAGCTCTCCTGGTGTGATACCCTTCGCCAGACGCCCTGAG
CAACCGTCCCCTCGCCAGCCTGAACGGCCGCCATTCAGCTACTCTCCTCCGCCATCCTTTAATCGGTCTGGATAC
CCGTCTCCCGGCAGGCCATTGCCCAAGGAGCCCTGGTCTCCGTTCCCTGGCGAGTCTGAAAAGCCCCACGGCCGG
AAGAGCCTGAAGAAATGGATGGGCCTGAAGAACTGGATGGGCCTGAAGATCTGGATGAGCCCGACTTTCCGTTCC
CCGGAGAGCCTGGAAGATTGGGCGAGCCCGGGCGTTCGTTCCCCGGAGAGCATCGACGACCGGGTCAGCCTGAAA
GGCAGGATGAGCCCGGGTTTCCGTTCCCCGACGAGTCCGAGAGGCCGAGCGAGCCTAGGCGTCCGTTTCCCGGCG
AACCTGAGAGACTCGATGAGCCTCGGCCATATTGGCCTGGTGCAACCGGACGTCCGTTCCACGGCAAGCATGAGA
GGCACGGTGAGGCCATTCCTCCGTTCCCCTACCGCCCGTCATCTAGCGAGCCCGGATATCTTCCCTACGGCAGGC
CGTCAGCCAGGCCCGCATCCCCTTTTCCCGGCGAGCCTCGATGGCCGGGCGAGACCGGACGTCCGTACCCTAGCG
AGCACCAGAGACCGAGTGAGCCTCGGCCTCCGTTCCCTATCGAGCCTTATTGGCCGGGTGAGACTGGACGTCCGT
TCCACAGCAAGCATGAGAGACCGGATGAGGCCAGACCTCCGTTCCCCTACCGCCCGTCAGCTAGCGAGCCCAGAT
ATCCCTTCCACGGTAGGCCATCAGCAAGGCCCGGTTACCCTTTCTCCGGTGAGAGTCATTGGCTGGGCGAGACCG
GACGTCCGTTTCATGGCGAGCCTCGATGGCCGAGCGAGACCGGACGTCCGTATCCCGGCGAGAATGAGGGGCCGG
GTGGTTTCAGATCTCCGTTCCATTCCCGTCCGTCAACCAGCGAGCCCGGATATCCTTTCCCCGGCAGACCGTCAC
CCAGGCCAGAATACCCGGCTCCCGGCGAGCACGAGAGACACGGCGAGCCTGAGGGGCCGGAAGAGTCTGAAAGGC
CGGGCGAGCCCGGTTATCCTTTCTCCGGCGAGCATGAGAGGCATGGCGAGCATGAGGGACATGGCGAGCATGAGA
GGCATGGTGAGCCTGGAAGACTGGGTGAGCCCGGATACCCATTCTCCGGAGAGCATGAGAAGCACGGCGAGCATG
AGAGGTCCGGTGAGCCCGGATACCCGTTCCCCGGCGAGCATGAGAGACATGCACGGCGAGCATGAGAGGCCCGGT
GAACCCGGTCATCCATTCCTCGGAGAGCACGAGAGGCCCGGCGAGCCTGGAAGACCGCATAAGCCCGGCTTCCCT
TTCCCCGGCGAGCATGAGAACCCATTCCCCGGCGAGCACGAGAAGCAAGGCGAGCATGAATACCCCTTCCCCGGT
GAGCATCACAGTCACGACGAGCCCGAAAGACAGCGTGAGCCCGGTTTCCCTCTCCCCGGCGAGCCTCAGAACCCA
TTCCACGGCGAGCACGAGAGGCACGGCGAGCACGAATACCCCTTCCCCGGTCAGCATCAGAAGCACGGTGAGCCC
GGATCTCCGTCCCCTGGCGAGCACGAGAGACACGGCGAGCCTGGATTCCCATTCCCCGGCGAGTCTGGCAAGCCC
CGTGAGCCATGGTTCCCGCTCCCCAGCGAGCCCAAGCCTCCCTTCCCCCGCGAAACCAACCCGTCATCACCCTGG
GACGAAGAAGAGCCCTCAGAATCCGAGCCAGCACTTCCCACGCCGCCCTCCGTCCGTTTCCCCCTCCCAGCTGGT
CCGGAACCAACGGCTATGCTCGAGAAGCTACCTCACTATCCGGATGATACCCTCTGGACGACTTCGACCATCTGG
ACGACCAGCGTACACACGGTGACGCACTGCCCTGCGCAGGTTGAGGATTGTCCTGCTCACAAGGCTCATACCATG
GTGGTGACGCGTACGATTGCTCTCTCGACCACCGTCTGTCCCGTTGAGTATGCAGGCCAGCAACCGACCAAATTC
CCCCTTCCGCCCGGTCCCTACAAGCAGCCTTCCGACCGCGAACCTCCCAGCCCAAGCGAGCCCTTCCATCCCAGC
CACTTGAAGTTCCCCATCGACGCACCCTTCAGGCCCGAGCCACGAATCGGCATCCCCTTCGGCACCGGCGTCCCC
CGACTCCACCGTCCAGACACCATGTTCCCCGGCCCTGACTCCCCCCCCGTCGTCGCAGAGAGGATCCCGATCCCC
GGTCCCGGCTTCGGTCCCCTTCCCTCCGCCGAAAGGGGGGCGGCGCCGAGGACTGAGTGGCAAGAAGAGCCCGAG
CCGACGACGCTGGCTCTCAAGGCTAGGCCTTCTGCGGGATGGCCGGCTGCTGCTCTGGAGGAGGCGCAGGCTGCC
ATGAGCTCTCCTGTTGTTACGGCGGCGGCGGGACGGGTCTCGAATCGGGTGTATAAGACTATTGCTTGTGTTGGT
GTTGTTGGGCTGATGGCTGTGCTTTGA
Transcript >Ophun1|4177
ATGTCGACTTCGGCGGCTATGGGGACGACGACGGCTTTCCCTTCAGCGACATTGGCCTTTCCGACGACCGCTGGC
AAGACTCGGGCTTCCCGACTGCGGATGGACCTCCCTTCGGAGGACCTGACGCGATCTCTCGCTCTGGCCGCGGCG
TTGGGCGTCACAGGTCTGGCCTTGACCTTGGGCTTGACGGGGCTGGCCTTGACCTTGGGCTTCACAGGTCCGGCC
GGGGCAAGGGGCTTCAAGGCTCTGGCGCTGGTTTTGGCCTTGATGGCTCTGGCTCTGACCTTGACTTTGGGCCTG
GCACCGGCTCCGGGCTTCGTGGCTCCAGCCCTGACGCTGACTTTGGATCTGACCTCGACTTTGGGCTTCACAGGT
CTGACCCTGATTTCGACTCTGAACCTGACCTTGATCTTGGGTTTGATGGGTCTAGCCGCCGTGTTGGGGTTCATG
GGTCTGGACGCCGGGTTGGGCTTCAGGGGTCTGGCGCTGGAGTTGGCTCTGGCGCCGGTCTTCGGCTTCATGGCT
CTGGTTCTGATCAGGACAACACACCAGGCATCGGCTTTGGTTCTCACAGGGTTGGCTCCGACTCCGACTTCGACC
CTGACTTTGACCTTGGGCTTGATGGCAATAGTCGCAGGCTCGGGATTCATGGGTCTGGCTACGGCTCAGCACGTC
AACGATCCGGAGCCGGCGTTGGAGCTCACGGACCTGTCCCCCGACTTGGACTTCATGGGTCTGGCTCCGACCCTG
ACTTTGACCTTGACCTTGATGGATCTGGCCCCGGTCTCGGGATTCATGGGCCTGGCTACGGCTCAGCGCGTCAAC
GTTCCAGAGCCGGCGTTGGAGTTCACGGACCTGTCCCCCGACCTAGGCTTTATAGGCCTGGCTACGACGTTGACT
CCGACCCTGACTTTGACCTTGATGGATCTGGTCTCGGTATTCATGGCTCTGGCCACGGCTCAGCGCGCCATGCGC
CAGGTGCCGGCGTCAAACTTCAGGGGTCTGCTCCCGGTCTTGGGCTTCACGGCTCTGTCCCTACCCCCAACCTTG
ATGATACTGACCTCGACATTGGGCTGGATGATTCTACCCCTGGCCTTGGGGTTCATGGGTCTGGCCACGGCGCTA
TGCATCATAGAATTGGCGCCGGCGTTGGACTTCATGCATCTGGCTCTGCCCCTGAGTTTGGCTTCGACTCTGACT
CGGACCCGGACTTTGACATTGGCTTCGGCCGTGGCTCCGGCAGTGGCCGTGTTCCCGCTGCTAAACACAGCATGG
CATGGCTCCGGCTTCACCTCTCATACCATGTCCCGCAGTGGCCGTGGCTCCGACGACGACTTAGACGACGACTTT
GGCCTTGGCATTGGCGAGGGTTCCCGCAGGGGAACCGGCAGGGGCTTTGGCATCGGCCACGGCTCCGGCAGGGGC
TCGAACATGGACGCTGACTTTGGCGAGGGCTTCGGCATCGGCCACGGCTCGGGCAGGGGTTCCGGTAGGGGCTTT
GGCGAGGGCTTTGGCTTTGGCGAGGGCTCCGGCGAGGGCTCCGGCGAGGGCTCCGGCAGGGACTCCGGCAGGGAC
TCCGGCAGGGGCATTGGCCAGGGCTCCGGCAGGGTCTCAGACATGGACGCCGACTTCGGAGAGGGCTTCGGCATC
CGCGAGGGCTCCGGCAGGGGCTCCGGCAGGGGCTCCGGCAAGAGCTTCGGCATTGGCGAGGACTCCGGCGAGGGT
GATGGTTCTGGCTCCGCGCCTGGCTCTCGCTCCTCCTTCACCAGCCAGTCATTCGGGCTCCCCGACACAACTCAA
CTCCTTCCAGGGCTATCCAATTTGCTGCCAGACTGGCTACGTCCGTTTCGAAGCCCCGATTCTCAAGCGAGCTCT
GTTACCCCGGCCTCATTCGACGCCCTTGCGCCTCCGTCCGGGATCCGATTCCCCCGTCCTCCGGGATTCCAAGTT
CCCAACCAAGGTTCTTCCGCGTCCACGTCCGGCTTCACCGCCCCGGCTTCTGGGCCGTCAAGCGCGCCGAAGAAT
GCATTCGGATCCAACGACCGGCCGTCTGTCTCGATGGGCGTCTCGTTTCCTAGTGTATCTGCGACTCCGTCGGCA
TCGTCCTCTTCTGCTAACAACCCGGACGACGCAACCCCATCGGCCTCGGAGCCTGAAAAGTCAACATCCGACCTT
TCTGCAACTGCGTCGTCGCAGCCCGACTCGTCTGTCCCCAGCTTGTTGGACTATCCTCTCATCTCGCTTCGTCAT
CCGGACGGGAACTCATCGTTACTGTCGCTTGCATCGTCACTGGGGCTTGACAAGCCATGGAATAGCGTCCGTTTA
CCGACAGGCTCATCGTCTGCCGATCGTTCAGATATTCCAAACGGACCTGACTCGCCATCGGATGACCCCGGTGTC
CCGTCGATATCTCTGTTTCCTTCGGGCACAAACCCGACGTCTCTTCAGCCCGACTCGACCCCTACCCAGGCTGCT
ATGTCAGCCGCCAGACCGCCTAAAGAGACTCGAGGCAGCTCTCCTGGTGTGATACCCTTCGCCAGACGCCCTGAG
CAACCGTCCCCTCGCCAGCCTGAACGGCCGCCATTCAGCTACTCTCCTCCGCCATCCTTTAATCGGTCTGGATAC
CCGTCTCCCGGCAGGCCATTGCCCAAGGAGCCCTGGTCTCCGTTCCCTGGCGAGTCTGAAAAGCCCCACGGCCGG
AAGAGCCTGAAGAAATGGATGGGCCTGAAGAACTGGATGGGCCTGAAGATCTGGATGAGCCCGACTTTCCGTTCC
CCGGAGAGCCTGGAAGATTGGGCGAGCCCGGGCGTTCGTTCCCCGGAGAGCATCGACGACCGGGTCAGCCTGAAA
GGCAGGATGAGCCCGGGTTTCCGTTCCCCGACGAGTCCGAGAGGCCGAGCGAGCCTAGGCGTCCGTTTCCCGGCG
AACCTGAGAGACTCGATGAGCCTCGGCCATATTGGCCTGGTGCAACCGGACGTCCGTTCCACGGCAAGCATGAGA
GGCACGGTGAGGCCATTCCTCCGTTCCCCTACCGCCCGTCATCTAGCGAGCCCGGATATCTTCCCTACGGCAGGC
CGTCAGCCAGGCCCGCATCCCCTTTTCCCGGCGAGCCTCGATGGCCGGGCGAGACCGGACGTCCGTACCCTAGCG
AGCACCAGAGACCGAGTGAGCCTCGGCCTCCGTTCCCTATCGAGCCTTATTGGCCGGGTGAGACTGGACGTCCGT
TCCACAGCAAGCATGAGAGACCGGATGAGGCCAGACCTCCGTTCCCCTACCGCCCGTCAGCTAGCGAGCCCAGAT
ATCCCTTCCACGGTAGGCCATCAGCAAGGCCCGGTTACCCTTTCTCCGGTGAGAGTCATTGGCTGGGCGAGACCG
GACGTCCGTTTCATGGCGAGCCTCGATGGCCGAGCGAGACCGGACGTCCGTATCCCGGCGAGAATGAGGGGCCGG
GTGGTTTCAGATCTCCGTTCCATTCCCGTCCGTCAACCAGCGAGCCCGGATATCCTTTCCCCGGCAGACCGTCAC
CCAGGCCAGAATACCCGGCTCCCGGCGAGCACGAGAGACACGGCGAGCCTGAGGGGCCGGAAGAGTCTGAAAGGC
CGGGCGAGCCCGGTTATCCTTTCTCCGGCGAGCATGAGAGGCATGGCGAGCATGAGGGACATGGCGAGCATGAGA
GGCATGGTGAGCCTGGAAGACTGGGTGAGCCCGGATACCCATTCTCCGGAGAGCATGAGAAGCACGGCGAGCATG
AGAGGTCCGGTGAGCCCGGATACCCGTTCCCCGGCGAGCATGAGAGACATGCACGGCGAGCATGAGAGGCCCGGT
GAACCCGGTCATCCATTCCTCGGAGAGCACGAGAGGCCCGGCGAGCCTGGAAGACCGCATAAGCCCGGCTTCCCT
TTCCCCGGCGAGCATGAGAACCCATTCCCCGGCGAGCACGAGAAGCAAGGCGAGCATGAATACCCCTTCCCCGGT
GAGCATCACAGTCACGACGAGCCCGAAAGACAGCGTGAGCCCGGTTTCCCTCTCCCCGGCGAGCCTCAGAACCCA
TTCCACGGCGAGCACGAGAGGCACGGCGAGCACGAATACCCCTTCCCCGGTCAGCATCAGAAGCACGGTGAGCCC
GGATCTCCGTCCCCTGGCGAGCACGAGAGACACGGCGAGCCTGGATTCCCATTCCCCGGCGAGTCTGGCAAGCCC
CGTGAGCCATGGTTCCCGCTCCCCAGCGAGCCCAAGCCTCCCTTCCCCCGCGAAACCAACCCGTCATCACCCTGG
GACGAAGAAGAGCCCTCAGAATCCGAGCCAGCACTTCCCACGCCGCCCTCCGTCCGTTTCCCCCTCCCAGCTGGT
CCGGAACCAACGGCTATGCTCGAGAAGCTACCTCACTATCCGGATGATACCCTCTGGACGACTTCGACCATCTGG
ACGACCAGCGTACACACGGTGACGCACTGCCCTGCGCAGGTTGAGGATTGTCCTGCTCACAAGGCTCATACCATG
GTGGTGACGCGTACGATTGCTCTCTCGACCACCGTCTGTCCCGTTGAGTATGCAGGCCAGCAACCGACCAAATTC
CCCCTTCCGCCCGGTCCCTACAAGCAGCCTTCCGACCGCGAACCTCCCAGCCCAAGCGAGCCCTTCCATCCCAGC
CACTTGAAGTTCCCCATCGACGCACCCTTCAGGCCCGAGCCACGAATCGGCATCCCCTTCGGCACCGGCGTCCCC
CGACTCCACCGTCCAGACACCATGTTCCCCGGCCCTGACTCCCCCCCCGTCGTCGCAGAGAGGATCCCGATCCCC
GGTCCCGGCTTCGGTCCCCTTCCCTCCGCCGAAAGGGGGGCGGCGCCGAGGACTGAGTGGCAAGAAGAGCCCGAG
CCGACGACGCTGGCTCTCAAGGCTAGGCCTTCTGCGGGATGGCCGGCTGCTGCTCTGGAGGAGGCGCAGGCTGCC
ATGAGCTCTCCTGTTGTTACGGCGGCGGCGGGACGGGTCTCGAATCGGGTGTATAAGACTATTGCTTGTGTTGGT
GTTGTTGGGCTGATGGCTGTGCTTTGA
Gene >Ophun1|4177
ATGTCGACTTCGGCGGCTATGGGGACGACGACGGCTTTCCCTTCAGCGACATTGGCCTTTCCGACGACCGCTGGC
AAGACTCGGGCTTCCCGACTGCGGATGGACCTCCCTTCGGAGGACCTGACGCGATCTCTCGCTCTGGCCGCGGCG
TTGGGCGTCACAGGTCTGGCCTTGACCTTGGGCTTGACGGGGCTGGCCTTGACCTTGGGCTTCACAGGTCCGGCC
GGGGCAAGGGGCTTCAAGGCTCTGGCGCTGGTTTTGGCCTTGATGGCTCTGGCTCTGACCTTGACTTTGGGCCTG
GCACCGGCTCCGGGCTTCGTGGCTCCAGCCCTGACGCTGACTTTGGATCTGACCTCGACTTTGGGCTTCACAGGT
CTGACCCTGATTTCGACTCTGAACCTGACCTTGATCTTGGGTTTGATGGGTCTAGCCGCCGTGTTGGGGTTCATG
GGTCTGGACGCCGGGTTGGGCTTCAGGGGTCTGGCGCTGGAGTTGGCTCTGGCGCCGGTCTTCGGCTTCATGGCT
CTGGTTCTGATCAGGACAACACACCAGGCATCGGCTTTGGTTCTCACAGGGTTGGCTCCGACTCCGACTTCGACC
CTGACTTTGACCTTGGGCTTGATGGCAATAGTCGCAGGCTCGGGATTCATGGGTCTGGCTACGGCTCAGCACGTC
AACGATCCGGAGCCGGCGTTGGAGCTCACGGACCTGTCCCCCGACTTGGACTTCATGGGTCTGGCTCCGACCCTG
ACTTTGACCTTGACCTTGATGGATCTGGCCCCGGTCTCGGGATTCATGGGCCTGGCTACGGCTCAGCGCGTCAAC
GTTCCAGAGCCGGCGTTGGAGTTCACGGACCTGTCCCCCGACCTAGGCTTTATAGGCCTGGCTACGACGTTGACT
CCGACCCTGACTTTGACCTTGATGGATCTGGTCTCGGTATTCATGGCTCTGGCCACGGCTCAGCGCGCCATGCGC
CAGGTGCCGGCGTCAAACTTCAGGGGTCTGCTCCCGGTCTTGGGCTTCACGGCTCTGTCCCTACCCCCAACCTTG
ATGATACTGACCTCGACATTGGGCTGGATGATTCTACCCCTGGCCTTGGGGTTCATGGGTCTGGCCACGGCGCTA
TGCATCATAGAATTGGCGCCGGCGTTGGACTTCATGCATCTGGCTCTGCCCCTGAGTTTGGCTTCGACTCTGACT
CGGACCCGGACTTTGACATTGGCTTCGGCCGTGGCTCCGGCAGTGGCCGTGTTCCCGCTGCTAAACACAGCATGG
TCAGAGTCGCTGCCTCTGGCAGTATCCCCAATGCCGCCTCTAGGGTTGGCCATGGCTCTAGGCATGGCTCCGGCT
TCACCTCTCATACCATGTCCCGCAGTGGCCGTGGCTCCGACGACGACTTAGACGACGACTTTGGCCTTGGCATTG
GCGAGGGTTCCCGCAGGGGAACCGGCAGGGGCTTTGGCATCGGCCACGGCTCCGGCAGGGGCTCGAACATGGACG
CTGACTTTGGCGAGGGCTTCGGCATCGGCCACGGCTCGGGCAGGGGTTCCGGTAGGGGCTTTGGCGAGGGCTTTG
GCTTTGGCGAGGGCTCCGGCGAGGGCTCCGGCGAGGGCTCCGGCAGGGACTCCGGCAGGGACTCCGGCAGGGGCA
TTGGCCAGGGCTCCGGCAGGGTCTCAGACATGGACGCCGACTTCGGAGAGGGCTTCGGCATCCGCGAGGGCTCCG
GCAGGGGCTCCGGCAGGGGCTCCGGCAAGAGCTTCGGCATTGGCGAGGACTCCGGCGAGGGTGATGGTTCTGGCT
CCGCGCCTGGCTCTCGCTCCTCCTTCACCAGCCAGTCATTCGGGCTCCCCGACACAACTCAACTCCTTCCAGGGC
TATCCAATTTGCTGCCAGACTGGCTACGTCCGTTTCGAAGCCCCGATTCTCAAGCGAGCTCTGTTACCCCGGCCT
CATTCGACGCCCTTGCGCCTCCGTCCGGGATCCGATTCCCCCGTCCTCCGGGATTCCAAGTTCCCAACCAAGGTT
CTTCCGCGTCCACGTCCGGCTTCACCGCCCCGGCTTCTGGGCCGTCAAGCGCGCCGAAGAATGCATTCGGATCCA
ACGACCGGCCGTCTGTCTCGATGGGCGTCTCGTTTCCTAGTGTATCTGCGACTCCGTCGGCATCGTCCTCTTCTG
CTAACAACCCGGACGACGCAACCCCATCGGCCTCGGAGCCTGAAAAGTCAACATCCGACCTTTCTGCAACTGCGT
CGTCGCAGCCCGACTCGTCTGTCCCCAGCTTGTTGGACTATCCTCTCATCTCGCTTCGTCATCCGGACGGGAACT
CATCGTTACTGTCGCTTGCATCGTCACTGGGGCTTGACAAGCCATGGAATAGCGTCCGTTTACCGACAGGCTCAT
CGTCTGCCGATCGTTCAGATATTCCAAACGGACCTGACTCGCCATCGGATGACCCCGGTGTCCCGTCGATATCTC
TGTTTCCTTCGGGCACAAACCCGACGTCTCTTCAGCCCGACTCGACCCCTACCCAGGCTGCTATGTCAGCCGCCA
GACCGCCTAAAGAGACTCGAGGCAGCTCTCCTGGTGTGATACCCTTCGCCAGACGCCCTGAGCAACCGTCCCCTC
GCCAGCCTGAACGGCCGCCATTCAGCTACTCTCCTCCGCCATCCTTTAATCGGTCTGGATACCCGTCTCCCGGCA
GGCCATTGCCCAAGGAGCCCTGGTCTCCGTTCCCTGGCGAGTCTGAAAAGCCCCGTGAGCCCGGATATCCTTTCC
CCAGCGCGCCTGTGAGACAGGGTGAGCCAGGACGTCTGTTCCCCGGAGAACATAGACGGCCGGGTGAGCCTGGAA
GGCCGGGCGAGTACGAGTCTCCGTTCCCCGGCGAGCCTGATATAATGGATGAGCCTGGACGTCTGTTCCCCGGAC
AGCATCAACGACCGGGTGAGCCTGAAGAATTAGAAGAGCCTGAAGAAATGGATGGGCCTGAAGAACTGGATGGGC
CTGAAGATCTGGATGAGCCCGACTTTCCGTTCCCCGGAGAGCCTGGAAGATTGGGCGAGCCCGGGCGTTCGTTCC
CCGGAGAGCATCGACGACCGGGTCAGCCTGAAAGGCAGGATGAGCCCGGGTTTCCGTTCCCCGACGAGTCCGAGA
GGCCGAGCGAGCCTAGGCGTCCGTTTCCCGGCGAACCTGAGAGACTCGATGAGCCTCGGCCATATTGGCCTGGTG
CAACCGGACGTCCGTTCCACGGCAAGCATGAGAGGCACGGTGAGGCCATTCCTCCGTTCCCCTACCGCCCGTCAT
CTAGCGAGCCCGGATATCTTCCCTACGGCAGGCCGTCAGCCAGGCCCGCATCCCCTTTTCCCGGCGAGCCTCGAT
GGCCGGGCGAGACCGGACGTCCGTACCCTAGCGAGCACCAGAGACCGAGTGAGCCTCGGCCTCCGTTCCCTATCG
AGCCTTATTGGCCGGGTGAGACTGGACGTCCGTTCCACAGCAAGCATGAGAGACCGGATGAGGCCAGACCTCCGT
TCCCCTACCGCCCGTCAGCTAGCGAGCCCAGATATCCCTTCCACGGTAGGCCATCAGCAAGGCCCGGTTACCCTT
TCTCCGGTGAGAGTCATTGGCTGGGCGAGACCGGACGTCCGTTTCATGGCGAGCCTCGATGGCCGAGCGAGACCG
GACGTCCGTATCCCGGCGAGAATGAGGGGCCGGGTGGTTTCAGATCTCCGTTCCATTCCCGTCCGTCAACCAGCG
AGCCCGGATATCCTTTCCCCGGCAGACCGTCACCCAGGCCAGAATACCCGGCTCCCGGCGAGCACGAGAGACACG
GCGAGCCTGAGGGGCCGGAAGAGTCTGAAAGGCCGGGCGAGCCCGGTTATCCTTTCTCCGGCGAGCATGAGAGGC
ATGGCGAGCATGAGGGACATGGCGAGCATGAGAGGCATGGTGAGCCTGGAAGACTGGGTGAGCCCGGATACCCAT
TCTCCGGAGAGCATGAGAAGCACGGCGAGCATGAGAGGTCCGGTGAGCCCGGATACCCGTTCCCCGGCGAGCATG
AGAGACATGGTGAGCCTGGAAAACTCGGTGAGCCCGGATACCCATTCTCCGGAGAGGATGAAAAGCACGGCGAGC
ATGAGAGGCCCGGTGAACCCGGTCATCCATTCCTCGGAGAGCACGAGAGGCCCGGCGAGCCTGGAAGACCGCATA
AGCCCGGCTTCCCTTTCCCCGGCGAGCATGAGAACCCATTCCCCGGCGAGCACGAGAAGCAAGGCGAGCATGAAT
ACCCCTTCCCCGGTGAGCATCACAGTCACGACGAGCCCGAAAGACAGCGTGAGCCCGGTTTCCCTCTCCCCGGCG
AGCCTCAGAACCCATTCCACGGCGAGCACGAGAGGCACGGCGAGCACGAATACCCCTTCCCCGGTCAGCATCAGA
AGCACGGTGAGCCCGGATCTCCGTCCCCTGGCGAGCACGAGAGACACGGCGAGCCTGGATTCCCATTCCCCGGCG
AGTCTGGCAAGCCCCGTGAGCCATGGTTCCCGCTCCCCAGCGAGCCCAAGCCTCCCTTCCCCCGCGAAACCAACC
CGTCATCACCCTGGGACGAAGAAGAGCCCTCAGAATCCGAGCCAGCACTTCCCACGCCGCCCTCCGTCCGTTTCC
CCCTCCCAGCTGGTCCGGAACCAACGGCTATGCTCGAGAAGCTACCTCACTATCCGGATGATACCCTCTGGACGA
CTTCGACCATCTGGACGACCAGCGTACACACGGTGACGCACTGCCCTGCGCAGGTTGAGGATTGTCCTGCTCACA
AGGCTCATACCATGGTGGTGACGCGTACGATTGCTCTCTCGACCACCGTCTGTCCCGTTGAGTATGCAGGCCAGC
AACCGACCAAATTCCCCCTTCCGCCCGGTCCCTACAAGCAGCCTTCCGACCGCGAACCTCCCAGCCCAAGCGAGC
CCTTCCATCCCAGCCACTTGAAGTTCCCCATCGACGCACCCTTCAGGCCCGAGCCACGAATCGGCATCCCCTTCG
GCACCGGCGTCCCCCGACTCCACCGTCCAGACACCATGTTCCCCGGCCCTGACTCCCCCCCCGTCGTCGCAGAGA
GGATCCCGATCCCCGGTCCCGGCTTCGGTCCCCTTCCCTCCGCCGAAAGGGGGGCGGCGCCGAGGACTGAGTGGC
AAGAAGAGCCCGAGCCGACGACGCTGGCTCTCAAGGCTAGGCCTTCTGCGGGATGGCCGGCTGCTGCTCTGGAGG
AGGCGCAGGCTGCCATGAGCTCTCCTGTTGTTACGGCGGCGGCGGGACGGGTCTCGAATCGGGTGTATAAGACTA
TTGCTTGTGTTGGTGTTGTTGGGCTGATGGCTGTGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail