Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4175
Gene name
LocationContig_382:13946..14303
Strand-
Gene length (bp)357
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999718

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup132
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4594
Ophiocordyceps australis map64 (Brazil) OphauB2|8119
Ophiocordyceps camponoti-floridani Ophcf2|02435
Ophiocordyceps camponoti-rufipedis Ophun1|4175 (this protein)
Ophiocordyceps kimflemingae Ophio5|7212
Ophiocordyceps kimflemingae Ophio5|7535
Ophiocordyceps kimflemingae Ophio5|7863
Ophiocordyceps subramaniannii Hirsu2|1066
Ophiocordyceps subramaniannii Hirsu2|2840
Ophiocordyceps subramaniannii Hirsu2|5867
Ophiocordyceps subramaniannii Hirsu2|7262
Ophiocordyceps subramaniannii Hirsu2|9763

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4175
MKFTIFALSLAGLVSAASAAESSMNTLQAGALDIGQLLGGLKPLLKKAKCIAPCITSKVDALKCEDGGPLTTICK
HVDDINKESEPCAKKCGVDKSMGGTILKVVKDLCKSHQKSKDE*
Coding >Ophun1|4175
ATGAAGTTCACCATCTTCGCCCTCTCCCTCGCCGGCCTCGTCAGCGCCGCCTCGGCCGCCGAGAGCAGCATGAAC
ACCCTCCAGGCCGGCGCCCTCGACATCGGCCAGCTTCTCGGCGGATTGAAGCCCCTGCTCAAGAAGGCCAAGTGC
ATAGCGCCCTGCATCACGAGCAAGGTAGATGCGCTCAAATGTGAAGACGGGGGCCCTCTCACCACCATCTGCAAG
CACGTCGACGACATCAACAAAGAGTCGGAGCCCTGCGCAAAAAAATGTGGCGTTGACAAGTCTATGGGAGGCACC
ATCTTGAAGGTTGTCAAGGACCTCTGCAAGTCACACCAGAAGAGCAAAGACGAATAG
Transcript >Ophun1|4175
ATGAAGTTCACCATCTTCGCCCTCTCCCTCGCCGGCCTCGTCAGCGCCGCCTCGGCCGCCGAGAGCAGCATGAAC
ACCCTCCAGGCCGGCGCCCTCGACATCGGCCAGCTTCTCGGCGGATTGAAGCCCCTGCTCAAGAAGGCCAAGTGC
ATAGCGCCCTGCATCACGAGCAAGGTAGATGCGCTCAAATGTGAAGACGGGGGCCCTCTCACCACCATCTGCAAG
CACGTCGACGACATCAACAAAGAGTCGGAGCCCTGCGCAAAAAAATGTGGCGTTGACAAGTCTATGGGAGGCACC
ATCTTGAAGGTTGTCAAGGACCTCTGCAAGTCACACCAGAAGAGCAAAGACGAATAG
Gene >Ophun1|4175
ATGAAGTTCACCATCTTCGCCCTCTCCCTCGCCGGCCTCGTCAGCGCCGCCTCGGCCGCCGAGAGCAGCATGAAC
ACCCTCCAGGCCGGCGCCCTCGACATCGGCCAGCTTCTCGGCGGATTGAAGCCCCTGCTCAAGAAGGCCAAGTGC
ATAGCGCCCTGCATCACGAGCAAGGTAGATGCGCTCAAATGTGAAGACGGGGGCCCTCTCACCACCATCTGCAAG
CACGTCGACGACATCAACAAAGAGTCGGAGCCCTGCGCAAAAAAATGTGGCGTTGACAAGTCTATGGGAGGCACC
ATCTTGAAGGTTGTCAAGGACCTCTGCAAGTCACACCAGAAGAGCAAAGACGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail