Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4173
Gene name
LocationContig_382:9029..10850
Strand-
Gene length (bp)1821
Transcript length (bp)1821
Coding sequence length (bp)1821
Protein length (aa) 607

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.2E-31 320 595
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.6E-17 311 596

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 324 574 6.0E-16
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 323 519 2.0E-14
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 372 511 1.0E-13
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 341 505 3.0E-13
sp|C0RW22|CDK14_DASNO Cyclin-dependent kinase 14 OS=Dasypus novemcinctus GN=CDK14 PE=3 SV=1 312 594 6.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 324 574 6.0E-16
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 323 519 2.0E-14
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 372 511 1.0E-13
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 341 505 3.0E-13
sp|C0RW22|CDK14_DASNO Cyclin-dependent kinase 14 OS=Dasypus novemcinctus GN=CDK14 PE=3 SV=1 312 594 6.0E-13
sp|B6A7Q3|CDK14_RABIT Cyclin-dependent kinase 14 OS=Oryctolagus cuniculus GN=CDK14 PE=3 SV=1 312 594 7.0E-13
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 373 512 8.0E-13
sp|Q3UMW7|MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus GN=Mapkapk3 PE=1 SV=2 387 605 8.0E-13
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 314 508 9.0E-13
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 310 517 1.0E-12
sp|B0VXE8|CDK14_CALJA Cyclin-dependent kinase 14 OS=Callithrix jacchus GN=CDK14 PE=3 SV=1 312 594 1.0E-12
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 377 514 1.0E-12
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 323 543 2.0E-12
sp|O94921|CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens GN=CDK14 PE=1 SV=3 312 594 2.0E-12
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 377 508 2.0E-12
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 345 521 2.0E-12
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 377 514 2.0E-12
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 326 596 2.0E-12
sp|B0VXL7|CDK14_CALMO Cyclin-dependent kinase 14 OS=Callicebus moloch GN=CDK14 PE=3 SV=1 312 594 2.0E-12
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 296 596 2.0E-12
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 323 514 2.0E-12
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 377 514 2.0E-12
sp|Q96285|LRK55_ARATH L-type lectin-domain containing receptor kinase V.5 OS=Arabidopsis thaliana GN=LECRK55 PE=1 SV=1 306 511 2.0E-12
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 315 505 2.0E-12
sp|Q3SYZ2|MAPK3_BOVIN MAP kinase-activated protein kinase 3 OS=Bos taurus GN=MAPKAPK3 PE=2 SV=1 387 512 3.0E-12
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 323 543 3.0E-12
sp|O35495|CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus GN=Cdk14 PE=1 SV=2 312 594 3.0E-12
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 324 502 3.0E-12
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 324 502 3.0E-12
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 324 502 3.0E-12
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 268 514 4.0E-12
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 310 514 5.0E-12
sp|Q16644|MAPK3_HUMAN MAP kinase-activated protein kinase 3 OS=Homo sapiens GN=MAPKAPK3 PE=1 SV=1 387 512 5.0E-12
sp|Q54QQ1|PHG2_DICDI Serine/threonine-protein kinase phg2 OS=Dictyostelium discoideum GN=phg2 PE=1 SV=1 316 510 5.0E-12
sp|Q66H84|MAPK3_RAT MAP kinase-activated protein kinase 3 OS=Rattus norvegicus GN=Mapkapk3 PE=2 SV=1 387 512 5.0E-12
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 298 512 5.0E-12
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 377 514 6.0E-12
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 389 508 6.0E-12
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 324 502 6.0E-12
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 312 515 6.0E-12
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 335 505 8.0E-12
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 314 512 8.0E-12
sp|P49137|MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens GN=MAPKAPK2 PE=1 SV=1 373 508 8.0E-12
sp|Q626B1|PMY13_CAEBR Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis briggsae GN=wee-1.3 PE=3 SV=1 419 571 9.0E-12
sp|P49139|MAPK2_RABIT MAP kinase-activated protein kinase 2 (Fragment) OS=Oryctolagus cuniculus GN=MAPKAPK2 PE=1 SV=2 373 508 9.0E-12
sp|Q9ZR79|LRK57_ARATH L-type lectin-domain containing receptor kinase V.7 OS=Arabidopsis thaliana GN=LECRK57 PE=2 SV=2 306 530 9.0E-12
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 312 505 9.0E-12
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 298 512 1.0E-11
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 313 596 1.0E-11
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 377 535 1.0E-11
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 377 505 1.0E-11
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 304 536 1.0E-11
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 341 595 1.0E-11
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 341 505 1.0E-11
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 312 594 1.0E-11
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 341 595 2.0E-11
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 291 588 2.0E-11
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 268 514 2.0E-11
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 341 505 2.0E-11
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 341 503 2.0E-11
sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wee1 PE=1 SV=1 408 516 2.0E-11
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 424 508 2.0E-11
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 341 505 2.0E-11
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 341 505 2.0E-11
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 389 514 2.0E-11
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 341 505 2.0E-11
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 424 508 2.0E-11
sp|P30290|MIK1_SCHPO Mitosis inhibitor protein kinase mik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mik1 PE=3 SV=1 420 516 2.0E-11
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 341 505 2.0E-11
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 341 505 2.0E-11
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 341 505 2.0E-11
sp|A4IIW7|CDK14_XENTR Cyclin-dependent kinase 14 OS=Xenopus tropicalis GN=cdk14 PE=2 SV=1 312 596 2.0E-11
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 341 505 2.0E-11
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 341 505 2.0E-11
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 335 530 2.0E-11
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 348 530 2.0E-11
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 298 512 3.0E-11
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 389 514 3.0E-11
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 341 505 3.0E-11
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 341 503 3.0E-11
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 341 505 3.0E-11
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 309 526 4.0E-11
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 341 503 4.0E-11
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 341 505 4.0E-11
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 416 508 5.0E-11
sp|P49138|MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus GN=Mapkapk2 PE=1 SV=2 313 512 5.0E-11
sp|P49136|MAPK2_CRILO MAP kinase-activated protein kinase 2 (Fragment) OS=Cricetulus longicaudatus GN=MAPKAPK2 PE=2 SV=1 373 508 5.0E-11
sp|Q9SJG2|Y2296_ARATH Probable receptor-like protein kinase At2g42960 OS=Arabidopsis thaliana GN=At2g42960 PE=3 SV=1 377 508 6.0E-11
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 383 512 6.0E-11
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 291 588 7.0E-11
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 373 542 8.0E-11
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 312 505 9.0E-11
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 328 502 9.0E-11
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 323 594 9.0E-11
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 323 594 9.0E-11
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 389 594 1.0E-10
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 323 594 1.0E-10
sp|Q6DJM7|CDK14_XENLA Cyclin-dependent kinase 14 OS=Xenopus laevis GN=cdk14 PE=2 SV=1 300 596 1.0E-10
sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kinase B OS=Trypanosoma brucei brucei GN=NRKB PE=2 SV=2 389 521 1.0E-10
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 308 512 1.0E-10
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 418 515 1.0E-10
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 389 517 1.0E-10
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 389 512 1.0E-10
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 373 542 1.0E-10
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 389 512 1.0E-10
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 418 515 1.0E-10
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 377 512 1.0E-10
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 341 505 1.0E-10
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 377 512 2.0E-10
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 418 514 2.0E-10
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 377 512 2.0E-10
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 324 530 2.0E-10
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 389 508 2.0E-10
sp|P49071|MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster GN=MAPk-Ak2 PE=2 SV=1 385 512 2.0E-10
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 291 588 2.0E-10
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 291 588 2.0E-10
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 377 508 2.0E-10
sp|O02827|MYLK_SHEEP Myosin light chain kinase, smooth muscle (Fragment) OS=Ovis aries GN=MYLK PE=2 SV=1 389 502 2.0E-10
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 389 505 2.0E-10
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 418 504 2.0E-10
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 389 505 2.0E-10
sp|Q9UU87|PPK34_SCHPO Serine/threonine-protein kinase ppk34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk34 PE=3 SV=2 389 596 2.0E-10
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 389 512 2.0E-10
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 389 505 2.0E-10
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 389 505 3.0E-10
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 389 505 3.0E-10
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 385 596 3.0E-10
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 389 522 3.0E-10
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 423 512 3.0E-10
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 385 512 3.0E-10
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 385 596 3.0E-10
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 385 596 3.0E-10
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 385 596 3.0E-10
sp|O04534|LRK51_ARATH Putative L-type lectin-domain containing receptor kinase V.1 OS=Arabidopsis thaliana GN=LECRK51 PE=3 SV=1 417 505 3.0E-10
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 291 513 4.0E-10
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 389 509 4.0E-10
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 304 512 4.0E-10
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 385 595 4.0E-10
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 405 501 4.0E-10
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 385 595 4.0E-10
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 385 596 5.0E-10
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 385 512 5.0E-10
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 377 508 5.0E-10
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 421 596 5.0E-10
sp|P46734|MP2K3_HUMAN Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens GN=MAP2K3 PE=1 SV=2 304 512 5.0E-10
sp|Q9FZB1|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1 382 515 5.0E-10
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 416 515 6.0E-10
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 345 512 6.0E-10
sp|O18209|PMY13_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.3 OS=Caenorhabditis elegans GN=wee-1.3 PE=1 SV=1 306 532 6.0E-10
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 307 515 6.0E-10
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 378 570 6.0E-10
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 314 541 6.0E-10
sp|O81069|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1 382 513 6.0E-10
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 389 508 6.0E-10
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 304 512 6.0E-10
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 389 504 6.0E-10
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 310 503 7.0E-10
sp|Q12126|CRK1_SCHPO Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crk1 PE=1 SV=1 389 512 7.0E-10
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 389 508 7.0E-10
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 389 508 7.0E-10
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 305 596 7.0E-10
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 373 597 8.0E-10
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 288 508 8.0E-10
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 418 596 9.0E-10
sp|Q03785|VHS1_YEAST Serine/threonine-protein kinase VHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHS1 PE=1 SV=1 422 599 9.0E-10
sp|Q9M1Z9|LRK58_ARATH Putative L-type lectin-domain containing receptor kinase V.8 OS=Arabidopsis thaliana GN=LECRK58 PE=3 SV=1 314 505 9.0E-10
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 323 603 9.0E-10
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 316 596 9.0E-10
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 296 512 9.0E-10
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 373 541 9.0E-10
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 310 570 1.0E-09
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 418 596 1.0E-09
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 309 536 1.0E-09
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 309 536 1.0E-09
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 385 596 1.0E-09
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 305 512 1.0E-09
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 309 536 1.0E-09
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 323 505 1.0E-09
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 389 595 1.0E-09
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 306 512 1.0E-09
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 389 512 1.0E-09
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 377 508 1.0E-09
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 326 514 1.0E-09
sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2 309 505 1.0E-09
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 389 512 1.0E-09
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 312 505 1.0E-09
sp|Q54TH6|Y9863_DICDI Probable serine/threonine-protein kinase DDB_G0281745 OS=Dictyostelium discoideum GN=DDB_G0281745 PE=3 SV=1 378 517 1.0E-09
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 419 514 1.0E-09
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 316 513 1.0E-09
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 389 508 1.0E-09
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 389 508 1.0E-09
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 323 505 1.0E-09
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 334 508 1.0E-09
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 418 515 1.0E-09
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 386 512 1.0E-09
sp|C0LGW2|PAM74_ARATH Probable LRR receptor-like serine/threonine-protein kinase PAM74 OS=Arabidopsis thaliana GN=PAM74 PE=2 SV=1 382 519 1.0E-09
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 419 514 1.0E-09
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 421 514 1.0E-09
sp|O22833|LRK54_ARATH L-type lectin-domain containing receptor kinase V.4 OS=Arabidopsis thaliana GN=LECRK54 PE=2 SV=1 416 505 1.0E-09
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 301 502 1.0E-09
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 301 502 1.0E-09
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 301 502 1.0E-09
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 301 502 1.0E-09
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 306 512 1.0E-09
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 373 597 1.0E-09
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 309 536 2.0E-09
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 395 536 2.0E-09
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 323 603 2.0E-09
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 418 504 2.0E-09
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 395 536 2.0E-09
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 348 519 2.0E-09
sp|Q20085|PMY11_CAEEL Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase wee-1.1 OS=Caenorhabditis elegans GN=wee-1.1 PE=2 SV=2 313 606 2.0E-09
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 275 525 2.0E-09
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 395 536 2.0E-09
sp|O09110|MP2K3_MOUSE Dual specificity mitogen-activated protein kinase kinase 3 OS=Mus musculus GN=Map2k3 PE=1 SV=2 304 512 2.0E-09
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 386 512 2.0E-09
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 418 514 2.0E-09
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 418 521 2.0E-09
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 419 514 2.0E-09
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 309 536 2.0E-09
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 372 505 2.0E-09
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 312 535 2.0E-09
sp|Q9FHK7|Y5516_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g05160 OS=Arabidopsis thaliana GN=At5g05160 PE=2 SV=1 313 508 2.0E-09
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 395 536 2.0E-09
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 279 525 2.0E-09
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 316 514 2.0E-09
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 309 536 2.0E-09
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 422 595 2.0E-09
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 284 521 2.0E-09
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 323 521 2.0E-09
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 377 514 2.0E-09
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 309 536 2.0E-09
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 309 536 2.0E-09
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 309 536 2.0E-09
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 418 521 2.0E-09
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 419 514 2.0E-09
sp|Q4V862|CDK9A_XENLA Cyclin-dependent kinase 9-A OS=Xenopus laevis GN=cdk9-a PE=2 SV=1 291 513 2.0E-09
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 418 521 2.0E-09
sp|Q54D75|Y2550_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 OS=Dictyostelium discoideum GN=DDB_G0292550 PE=3 SV=1 314 508 2.0E-09
sp|Q5AP97|SWE1_CANAL Mitosis inhibitor protein kinase SWE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWE1 PE=1 SV=1 388 516 2.0E-09
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 296 512 2.0E-09
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 301 502 2.0E-09
sp|Q9LMT9|WAKLL_ARATH Putative wall-associated receptor kinase-like 13 OS=Arabidopsis thaliana GN=WAKL13 PE=3 SV=1 391 566 2.0E-09
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 416 508 3.0E-09
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 418 506 3.0E-09
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 316 512 3.0E-09
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 416 530 3.0E-09
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 389 505 3.0E-09
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 416 508 3.0E-09
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 389 508 3.0E-09
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 309 536 3.0E-09
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 419 514 3.0E-09
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 389 505 3.0E-09
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 303 596 3.0E-09
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 386 519 3.0E-09
sp|P45985|MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens GN=MAP2K4 PE=1 SV=1 316 514 3.0E-09
sp|P47809|MP2K4_MOUSE Dual specificity mitogen-activated protein kinase kinase 4 OS=Mus musculus GN=Map2k4 PE=1 SV=2 316 514 3.0E-09
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 388 508 3.0E-09
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 389 505 3.0E-09
sp|Q07192|MP2K2_XENLA Dual specificity mitogen-activated protein kinase kinase 2 (Fragment) OS=Xenopus laevis GN=map2k2 PE=1 SV=1 316 514 3.0E-09
sp|Q8LEB6|Y5185_ARATH Probable receptor-like protein kinase At5g18500 OS=Arabidopsis thaliana GN=At5g18500 PE=2 SV=1 309 517 3.0E-09
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 377 508 3.0E-09
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 389 508 3.0E-09
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 378 512 3.0E-09
sp|Q9LN59|WAKLK_ARATH Putative wall-associated receptor kinase-like 11 OS=Arabidopsis thaliana GN=WAKL11 PE=3 SV=2 309 505 3.0E-09
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 290 508 3.0E-09
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 430 560 3.0E-09
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 335 512 3.0E-09
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 335 512 3.0E-09
sp|Q6GLD8|CDK9_XENTR Cyclin-dependent kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1 291 513 4.0E-09
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 335 512 4.0E-09
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 335 512 4.0E-09
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 382 530 4.0E-09
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 374 514 4.0E-09
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 389 508 4.0E-09
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 301 508 4.0E-09
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 389 508 4.0E-09
sp|Q8GXQ3|WAKLF_ARATH Wall-associated receptor kinase-like 6 OS=Arabidopsis thaliana GN=WAKL6 PE=2 SV=2 309 522 4.0E-09
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 337 512 4.0E-09
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 311 505 4.0E-09
sp|Q8SR86|CDK1_ENCCU Cyclin-dependent kinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC28 PE=3 SV=1 310 544 4.0E-09
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 326 508 4.0E-09
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 391 596 4.0E-09
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 326 514 4.0E-09
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 389 516 4.0E-09
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 416 508 4.0E-09
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 373 597 4.0E-09
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 389 504 5.0E-09
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 416 508 5.0E-09
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 323 505 5.0E-09
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 389 504 5.0E-09
sp|Q90ZY4|SBK1_DANRE Serine/threonine-protein kinase SBK1 OS=Danio rerio GN=sbk1 PE=1 SV=1 420 508 5.0E-09
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 418 514 5.0E-09
sp|Q99078|FUZ7_USTMA Dual specificity protein kinase FUZ7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FUZ7 PE=3 SV=2 338 517 5.0E-09
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 296 505 5.0E-09
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 326 514 5.0E-09
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 418 514 5.0E-09
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 395 504 5.0E-09
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 326 514 5.0E-09
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 301 514 5.0E-09
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 424 597 5.0E-09
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 377 516 5.0E-09
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 382 508 5.0E-09
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 387 551 6.0E-09
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 389 519 6.0E-09
sp|C0LGG4|Y1518_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51860 OS=Arabidopsis thaliana GN=At1g51860 PE=2 SV=2 382 515 6.0E-09
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 322 508 6.0E-09
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 389 504 6.0E-09
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 323 514 6.0E-09
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 386 504 6.0E-09
sp|Q24210|CSKP_DROME Peripheral plasma membrane protein CASK OS=Drosophila melanogaster GN=CASK PE=1 SV=4 388 522 6.0E-09
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 376 529 6.0E-09
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 329 505 6.0E-09
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 377 526 6.0E-09
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 323 521 6.0E-09
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 346 504 6.0E-09
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 389 504 6.0E-09
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 389 509 7.0E-09
sp|P54739|PKAA_STRCO Serine/threonine-protein kinase PkaA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pkaA PE=3 SV=1 321 508 7.0E-09
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 389 509 7.0E-09
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 316 505 7.0E-09
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 420 514 7.0E-09
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 314 505 7.0E-09
sp|Q9LRP3|Y3174_ARATH Probable receptor-like protein kinase At3g17420 OS=Arabidopsis thaliana GN=At3g17420 PE=1 SV=1 377 519 7.0E-09
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 315 501 7.0E-09
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 311 514 7.0E-09
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 391 519 7.0E-09
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 421 514 7.0E-09
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 314 505 7.0E-09
sp|Q9ZRF9|RPK1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RPK1 OS=Arabidopsis thaliana GN=RPK1 PE=1 SV=1 417 505 8.0E-09
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 423 536 8.0E-09
sp|O04533|LRK52_ARATH Putative L-type lectin-domain containing receptor kinase V.2 OS=Arabidopsis thaliana GN=LECRK52 PE=3 SV=1 417 505 8.0E-09
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 419 595 8.0E-09
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 373 541 8.0E-09
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 375 561 8.0E-09
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 302 508 8.0E-09
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 416 502 8.0E-09
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 418 517 8.0E-09
sp|C0LGG6|Y5189_ARATH Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana GN=At1g51890 PE=2 SV=2 382 535 8.0E-09
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 423 530 9.0E-09
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 389 508 9.0E-09
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 424 539 9.0E-09
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 421 596 9.0E-09
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 386 504 9.0E-09
sp|C0LGT5|Y5169_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1 382 513 9.0E-09
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 418 517 9.0E-09
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 331 508 9.0E-09
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 316 516 9.0E-09
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 389 514 9.0E-09
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 419 593 1.0E-08
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 304 510 1.0E-08
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 341 505 1.0E-08
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 378 525 1.0E-08
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 376 508 1.0E-08
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 391 514 1.0E-08
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 391 514 1.0E-08
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 424 512 1.0E-08
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 331 508 1.0E-08
sp|Q95QC4|DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans GN=zyg-8 PE=1 SV=1 419 508 1.0E-08
sp|Q696W0|SPEG_DANRE Striated muscle preferentially expressed protein kinase OS=Danio rerio GN=speg PE=2 SV=1 359 524 1.0E-08
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 389 596 1.0E-08
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 376 512 1.0E-08
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 389 514 1.0E-08
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 313 502 1.0E-08
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 309 520 1.0E-08
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 391 596 1.0E-08
sp|Q7ZX42|CDK9B_XENLA Cyclin-dependent kinase 9-B OS=Xenopus laevis GN=cdk9-b PE=2 SV=1 295 513 1.0E-08
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 383 504 1.0E-08
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 423 537 1.0E-08
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 360 512 1.0E-08
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 389 504 1.0E-08
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 382 502 1.0E-08
sp|Q2QRN7|CHARK_ORYSJ Probable kinase CHARK OS=Oryza sativa subsp. japonica GN=CHARK PE=2 SV=1 405 505 1.0E-08
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 323 521 1.0E-08
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 418 517 1.0E-08
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 394 508 1.0E-08
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 323 512 1.0E-08
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 377 521 1.0E-08
sp|Q9LEA3|LRK56_ARATH Putative L-type lectin-domain containing receptor kinase V.6 OS=Arabidopsis thaliana GN=LECRK56 PE=3 SV=3 306 488 1.0E-08
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 326 508 1.0E-08
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 416 502 1.0E-08
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 297 550 1.0E-08
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 418 508 1.0E-08
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 416 502 1.0E-08
sp|Q9SYS7|CRK39_ARATH Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=3 SV=1 416 505 1.0E-08
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 283 506 1.0E-08
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 424 511 1.0E-08
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 418 521 1.0E-08
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 309 508 1.0E-08
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 341 505 1.0E-08
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 419 519 1.0E-08
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 301 512 2.0E-08
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 391 514 2.0E-08
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 323 512 2.0E-08
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 423 508 2.0E-08
sp|Q5E9X2|MP2K6_BOVIN Dual specificity mitogen-activated protein kinase kinase 6 OS=Bos taurus GN=MAP2K6 PE=2 SV=1 375 512 2.0E-08
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 394 508 2.0E-08
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 424 504 2.0E-08
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 418 505 2.0E-08
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 383 504 2.0E-08
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 295 515 2.0E-08
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 389 514 2.0E-08
sp|O64483|SIRK_ARATH Senescence-induced receptor-like serine/threonine-protein kinase OS=Arabidopsis thaliana GN=SIRK PE=2 SV=1 316 505 2.0E-08
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 323 521 2.0E-08
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 377 510 2.0E-08
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 427 521 2.0E-08
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 427 521 2.0E-08
sp|P52564|MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens GN=MAP2K6 PE=1 SV=1 375 512 2.0E-08
sp|P70236|MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus GN=Map2k6 PE=1 SV=1 375 512 2.0E-08
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 391 596 2.0E-08
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 430 513 2.0E-08
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 387 508 2.0E-08
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 312 505 2.0E-08
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 420 513 2.0E-08
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 416 502 2.0E-08
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 377 508 2.0E-08
sp|Q55CL6|MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1 307 512 2.0E-08
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 419 502 2.0E-08
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 377 508 2.0E-08
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 331 508 2.0E-08
sp|O49445|LRK72_ARATH Probable L-type lectin-domain containing receptor kinase VII.2 OS=Arabidopsis thaliana GN=LECRK72 PE=3 SV=2 417 517 2.0E-08
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 376 512 2.0E-08
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 377 510 2.0E-08
sp|P41719|PK1_NPVHZ Serine/threonine-protein kinase 1 OS=Heliothis zea nuclear polyhedrosis virus GN=PK1 PE=3 SV=1 423 502 2.0E-08
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 376 512 2.0E-08
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 346 502 2.0E-08
sp|P32593|MOS_MSVMT Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain ts110) GN=V-MOS PE=3 SV=1 316 504 2.0E-08
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 377 508 2.0E-08
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 377 512 2.0E-08
sp|Q9FKG5|PUB51_ARATH U-box domain-containing protein 51 OS=Arabidopsis thaliana GN=PUB51 PE=2 SV=2 417 505 2.0E-08
sp|C0LGR6|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2 367 505 2.0E-08
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 422 595 2.0E-08
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 377 502 2.0E-08
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 313 595 2.0E-08
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 377 502 2.0E-08
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 312 595 2.0E-08
sp|Q9S7I6|RPK2_ARATH LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=2 SV=1 377 508 2.0E-08
sp|Q61RA2|CHK1_CAEBR Serine/threonine-protein kinase chk-1 OS=Caenorhabditis briggsae GN=chk-1 PE=3 SV=1 430 529 2.0E-08
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 377 510 2.0E-08
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 302 534 3.0E-08
sp|P28708|PRR1_YEAST Serine/threonine-protein kinase PRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR1 PE=1 SV=1 331 519 3.0E-08
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 422 510 3.0E-08
sp|Q9LK43|TMK4_ARATH Receptor-like kinase TMK4 OS=Arabidopsis thaliana GN=TMK4 PE=1 SV=1 416 520 3.0E-08
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 387 508 3.0E-08
sp|Q3EDL4|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2 377 535 3.0E-08
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 430 536 3.0E-08
sp|P00538|MOS_MSVMO Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus GN=V-MOS PE=3 SV=1 316 504 3.0E-08
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 377 510 3.0E-08
sp|Q1RLU9|CDK15_DANRE Cyclin-dependent kinase 15 OS=Danio rerio GN=cdk15 PE=2 SV=1 316 589 3.0E-08
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 377 508 3.0E-08
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 314 574 3.0E-08
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 430 527 3.0E-08
sp|Q9SYS3|CRK40_ARATH Cysteine-rich receptor-like protein kinase 40 OS=Arabidopsis thaliana GN=CRK40 PE=2 SV=1 416 505 3.0E-08
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 418 515 3.0E-08
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 419 595 3.0E-08
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 419 514 3.0E-08
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 419 514 3.0E-08
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 430 536 3.0E-08
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 385 537 3.0E-08
sp|Q9FN93|Y5596_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g59680 OS=Arabidopsis thaliana GN=At5g59680 PE=2 SV=1 382 534 3.0E-08
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 391 596 3.0E-08
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 418 520 3.0E-08
sp|P41720|PK1_NPVLD Serine/threonine-protein kinase 1 OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=PK1 PE=2 SV=1 430 508 3.0E-08
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 430 505 3.0E-08
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 423 512 3.0E-08
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 306 508 3.0E-08
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 308 508 3.0E-08
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 393 505 3.0E-08
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 430 512 3.0E-08
sp|Q9GN62|PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans GN=par-4 PE=1 SV=2 416 508 3.0E-08
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 297 537 3.0E-08
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 389 593 3.0E-08
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 419 514 3.0E-08
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 423 560 4.0E-08
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 297 542 4.0E-08
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 377 502 4.0E-08
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 430 513 4.0E-08
sp|P0CD62|LIMKB_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 OS=Dictyostelium discoideum GN=DDB_G0286997 PE=3 SV=1 313 510 4.0E-08
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 430 512 4.0E-08
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 419 508 4.0E-08
sp|Q4R945|TTK_MACFA Dual specificity protein kinase TTK OS=Macaca fascicularis GN=TTK PE=2 SV=1 286 506 4.0E-08
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 419 596 4.0E-08
sp|Q12505|SKS1_YEAST Serine/threonine-protein kinase SKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKS1 PE=1 SV=1 422 599 4.0E-08
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 375 594 4.0E-08
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 430 512 4.0E-08
sp|G5EDF7|SEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase sek-1 OS=Caenorhabditis elegans GN=sek-1 PE=1 SV=1 374 523 4.0E-08
sp|P84199|NEKL4_CAEEL Serine/threonine-protein kinase D1044.8 OS=Caenorhabditis elegans GN=nekl-4 PE=3 SV=2 415 504 4.0E-08
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 418 522 4.0E-08
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 378 508 4.0E-08
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 377 526 4.0E-08
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 301 506 4.0E-08
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 430 527 5.0E-08
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 316 555 5.0E-08
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 296 508 5.0E-08
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 430 527 5.0E-08
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 377 502 5.0E-08
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 383 581 5.0E-08
sp|P33981|TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens GN=TTK PE=1 SV=2 286 506 5.0E-08
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 430 512 5.0E-08
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 416 502 5.0E-08
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 389 508 7.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 389 508 7.0E-08
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 389 508 1.0E-07
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 389 508 2.0E-07
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 389 508 2.0E-07
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 389 508 2.0E-07
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 389 508 2.0E-07
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 389 545 3.0E-07
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 389 508 3.0E-07
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 389 508 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4173
MADLSEERTEERTEPVSVQSEVDVRSLDEPTFPLDDDGNHAVSLDSLQVEGHHNFRILVRPLTKLPGVRSISPGS
DNCQWLALRAPVSLSEHKVLAVTQTANDIKFSVRIPGESSRPPLWCELYYDPAGDSIICLNRSDLPISLVGAPNP
SLRLAVSPPPQYFINPGFAKSLGPGTWRILARSIAVLEFRVLERRPVTVYQIASGDKAPSSSIASPTSGKRLLTS
ENDGRDYRDGAGLDGGRRLTKKRLSDARHEPDDEDVVMFLNPAQPLNFPSPNKELSVISGHALVEAQPGDTISVP
GVCEVQAYQLTKGQVIASTAQSAVYKAAYSKVPGKLVTVKVLKTCLTESQPMASVRQAETWLRESSKMASFDSSC
DSIVRFYGGDARMLSMYLEFVDAADLAAASWRSKTDDFTGTWEDAWRILADISLALHYIHQRKLVHNDIKPANIL
YSPERGAVLCDFGLLNSAASPAHTGGTPYYVPPEFIGTKLRGPPSDVWALGVTMLYALRRIPLPDSRARLKNPKR
LYWLISAINNPSAVHNLGNGQPAVKQMGDWLKEICEAQEKLNSRDRLQRIVREMLHINPTQRITMAMVLQELQAE
QTVAVR*
Coding >Ophun1|4173
ATGGCCGACTTGTCCGAGGAGAGGACGGAGGAGAGGACGGAACCAGTCTCGGTCCAGTCCGAAGTCGACGTCCGG
AGCCTGGATGAGCCGACTTTTCCCCTCGACGATGACGGCAACCATGCCGTCTCACTCGATTCCCTCCAGGTCGAG
GGCCACCACAACTTCCGCATCCTCGTCCGGCCCCTCACTAAGCTCCCCGGCGTCCGCTCCATCAGCCCTGGGAGC
GACAACTGCCAGTGGCTCGCCCTCCGGGCCCCGGTGTCTCTCTCTGAACACAAGGTGCTGGCCGTGACGCAGACG
GCCAATGACATCAAGTTCTCCGTCCGCATCCCCGGCGAGTCGTCGAGGCCGCCGCTGTGGTGCGAGCTCTACTAC
GACCCGGCCGGTGACAGCATCATATGCCTGAATCGCTCCGATCTCCCCATATCTCTCGTCGGCGCCCCCAATCCC
TCCCTCCGGCTCGCCGTCAGCCCGCCGCCGCAGTACTTCATTAATCCGGGATTCGCAAAGTCGTTGGGACCGGGC
ACTTGGCGCATCCTCGCCCGCAGCATAGCCGTCCTCGAGTTTCGCGTGCTGGAGAGGCGGCCCGTGACCGTCTAT
CAGATCGCGTCCGGGGACAAGGCACCCTCGAGCTCTATCGCCTCGCCCACCAGCGGCAAGCGGTTGCTGACATCG
GAGAACGACGGTCGCGACTACCGTGACGGCGCGGGCTTAGACGGCGGCAGGCGACTCACAAAGAAGCGGTTATCG
GATGCGCGACACGAGCCTGACGACGAGGATGTCGTCATGTTCCTTAACCCGGCCCAGCCGCTCAACTTTCCGTCG
CCCAACAAGGAACTCTCTGTCATCAGCGGCCACGCCCTGGTCGAGGCCCAACCGGGGGACACCATCTCGGTACCA
GGCGTGTGCGAGGTCCAAGCCTACCAGCTCACCAAGGGTCAGGTGATTGCGTCGACGGCCCAGTCGGCCGTGTAC
AAGGCCGCCTACTCCAAGGTGCCCGGAAAGCTGGTGACGGTCAAGGTTCTCAAGACGTGCCTGACCGAGTCGCAG
CCCATGGCCAGCGTCAGGCAAGCCGAGACGTGGCTGCGCGAGTCGTCCAAGATGGCCAGCTTCGACTCGAGCTGC
GACTCCATCGTTCGCTTCTACGGCGGCGACGCGCGAATGCTATCCATGTATCTCGAGTTCGTCGACGCGGCCGAT
CTGGCAGCGGCCTCTTGGAGGAGCAAGACGGACGACTTTACCGGCACCTGGGAGGACGCATGGCGGATCCTGGCC
GACATCTCGCTCGCGCTTCACTACATTCACCAGCGCAAGCTCGTCCACAACGACATCAAGCCGGCCAACATTCTC
TACTCGCCCGAGCGCGGTGCCGTTCTCTGCGATTTTGGCCTGCTCAACTCTGCCGCCAGCCCGGCCCACACCGGA
GGCACGCCCTATTACGTGCCGCCCGAGTTCATAGGCACCAAGCTGCGAGGGCCGCCGTCGGACGTGTGGGCGCTG
GGCGTGACGATGCTGTACGCGTTGCGGCGCATCCCGCTGCCCGACAGTCGCGCCCGGCTCAAGAACCCGAAGCGG
CTATACTGGCTCATCAGCGCCATCAACAACCCGTCGGCCGTCCACAACCTCGGAAACGGCCAGCCGGCAGTAAAG
CAGATGGGCGACTGGCTGAAGGAAATTTGCGAGGCGCAGGAGAAGCTCAACTCGCGCGACCGGCTGCAGCGCATC
GTGCGGGAGATGCTCCACATCAACCCCACGCAACGCATCACCATGGCCATGGTGTTGCAAGAGCTACAGGCGGAA
CAGACGGTGGCCGTCCGCTAA
Transcript >Ophun1|4173
ATGGCCGACTTGTCCGAGGAGAGGACGGAGGAGAGGACGGAACCAGTCTCGGTCCAGTCCGAAGTCGACGTCCGG
AGCCTGGATGAGCCGACTTTTCCCCTCGACGATGACGGCAACCATGCCGTCTCACTCGATTCCCTCCAGGTCGAG
GGCCACCACAACTTCCGCATCCTCGTCCGGCCCCTCACTAAGCTCCCCGGCGTCCGCTCCATCAGCCCTGGGAGC
GACAACTGCCAGTGGCTCGCCCTCCGGGCCCCGGTGTCTCTCTCTGAACACAAGGTGCTGGCCGTGACGCAGACG
GCCAATGACATCAAGTTCTCCGTCCGCATCCCCGGCGAGTCGTCGAGGCCGCCGCTGTGGTGCGAGCTCTACTAC
GACCCGGCCGGTGACAGCATCATATGCCTGAATCGCTCCGATCTCCCCATATCTCTCGTCGGCGCCCCCAATCCC
TCCCTCCGGCTCGCCGTCAGCCCGCCGCCGCAGTACTTCATTAATCCGGGATTCGCAAAGTCGTTGGGACCGGGC
ACTTGGCGCATCCTCGCCCGCAGCATAGCCGTCCTCGAGTTTCGCGTGCTGGAGAGGCGGCCCGTGACCGTCTAT
CAGATCGCGTCCGGGGACAAGGCACCCTCGAGCTCTATCGCCTCGCCCACCAGCGGCAAGCGGTTGCTGACATCG
GAGAACGACGGTCGCGACTACCGTGACGGCGCGGGCTTAGACGGCGGCAGGCGACTCACAAAGAAGCGGTTATCG
GATGCGCGACACGAGCCTGACGACGAGGATGTCGTCATGTTCCTTAACCCGGCCCAGCCGCTCAACTTTCCGTCG
CCCAACAAGGAACTCTCTGTCATCAGCGGCCACGCCCTGGTCGAGGCCCAACCGGGGGACACCATCTCGGTACCA
GGCGTGTGCGAGGTCCAAGCCTACCAGCTCACCAAGGGTCAGGTGATTGCGTCGACGGCCCAGTCGGCCGTGTAC
AAGGCCGCCTACTCCAAGGTGCCCGGAAAGCTGGTGACGGTCAAGGTTCTCAAGACGTGCCTGACCGAGTCGCAG
CCCATGGCCAGCGTCAGGCAAGCCGAGACGTGGCTGCGCGAGTCGTCCAAGATGGCCAGCTTCGACTCGAGCTGC
GACTCCATCGTTCGCTTCTACGGCGGCGACGCGCGAATGCTATCCATGTATCTCGAGTTCGTCGACGCGGCCGAT
CTGGCAGCGGCCTCTTGGAGGAGCAAGACGGACGACTTTACCGGCACCTGGGAGGACGCATGGCGGATCCTGGCC
GACATCTCGCTCGCGCTTCACTACATTCACCAGCGCAAGCTCGTCCACAACGACATCAAGCCGGCCAACATTCTC
TACTCGCCCGAGCGCGGTGCCGTTCTCTGCGATTTTGGCCTGCTCAACTCTGCCGCCAGCCCGGCCCACACCGGA
GGCACGCCCTATTACGTGCCGCCCGAGTTCATAGGCACCAAGCTGCGAGGGCCGCCGTCGGACGTGTGGGCGCTG
GGCGTGACGATGCTGTACGCGTTGCGGCGCATCCCGCTGCCCGACAGTCGCGCCCGGCTCAAGAACCCGAAGCGG
CTATACTGGCTCATCAGCGCCATCAACAACCCGTCGGCCGTCCACAACCTCGGAAACGGCCAGCCGGCAGTAAAG
CAGATGGGCGACTGGCTGAAGGAAATTTGCGAGGCGCAGGAGAAGCTCAACTCGCGCGACCGGCTGCAGCGCATC
GTGCGGGAGATGCTCCACATCAACCCCACGCAACGCATCACCATGGCCATGGTGTTGCAAGAGCTACAGGCGGAA
CAGACGGTGGCCGTCCGCTAA
Gene >Ophun1|4173
ATGGCCGACTTGTCCGAGGAGAGGACGGAGGAGAGGACGGAACCAGTCTCGGTCCAGTCCGAAGTCGACGTCCGG
AGCCTGGATGAGCCGACTTTTCCCCTCGACGATGACGGCAACCATGCCGTCTCACTCGATTCCCTCCAGGTCGAG
GGCCACCACAACTTCCGCATCCTCGTCCGGCCCCTCACTAAGCTCCCCGGCGTCCGCTCCATCAGCCCTGGGAGC
GACAACTGCCAGTGGCTCGCCCTCCGGGCCCCGGTGTCTCTCTCTGAACACAAGGTGCTGGCCGTGACGCAGACG
GCCAATGACATCAAGTTCTCCGTCCGCATCCCCGGCGAGTCGTCGAGGCCGCCGCTGTGGTGCGAGCTCTACTAC
GACCCGGCCGGTGACAGCATCATATGCCTGAATCGCTCCGATCTCCCCATATCTCTCGTCGGCGCCCCCAATCCC
TCCCTCCGGCTCGCCGTCAGCCCGCCGCCGCAGTACTTCATTAATCCGGGATTCGCAAAGTCGTTGGGACCGGGC
ACTTGGCGCATCCTCGCCCGCAGCATAGCCGTCCTCGAGTTTCGCGTGCTGGAGAGGCGGCCCGTGACCGTCTAT
CAGATCGCGTCCGGGGACAAGGCACCCTCGAGCTCTATCGCCTCGCCCACCAGCGGCAAGCGGTTGCTGACATCG
GAGAACGACGGTCGCGACTACCGTGACGGCGCGGGCTTAGACGGCGGCAGGCGACTCACAAAGAAGCGGTTATCG
GATGCGCGACACGAGCCTGACGACGAGGATGTCGTCATGTTCCTTAACCCGGCCCAGCCGCTCAACTTTCCGTCG
CCCAACAAGGAACTCTCTGTCATCAGCGGCCACGCCCTGGTCGAGGCCCAACCGGGGGACACCATCTCGGTACCA
GGCGTGTGCGAGGTCCAAGCCTACCAGCTCACCAAGGGTCAGGTGATTGCGTCGACGGCCCAGTCGGCCGTGTAC
AAGGCCGCCTACTCCAAGGTGCCCGGAAAGCTGGTGACGGTCAAGGTTCTCAAGACGTGCCTGACCGAGTCGCAG
CCCATGGCCAGCGTCAGGCAAGCCGAGACGTGGCTGCGCGAGTCGTCCAAGATGGCCAGCTTCGACTCGAGCTGC
GACTCCATCGTTCGCTTCTACGGCGGCGACGCGCGAATGCTATCCATGTATCTCGAGTTCGTCGACGCGGCCGAT
CTGGCAGCGGCCTCTTGGAGGAGCAAGACGGACGACTTTACCGGCACCTGGGAGGACGCATGGCGGATCCTGGCC
GACATCTCGCTCGCGCTTCACTACATTCACCAGCGCAAGCTCGTCCACAACGACATCAAGCCGGCCAACATTCTC
TACTCGCCCGAGCGCGGTGCCGTTCTCTGCGATTTTGGCCTGCTCAACTCTGCCGCCAGCCCGGCCCACACCGGA
GGCACGCCCTATTACGTGCCGCCCGAGTTCATAGGCACCAAGCTGCGAGGGCCGCCGTCGGACGTGTGGGCGCTG
GGCGTGACGATGCTGTACGCGTTGCGGCGCATCCCGCTGCCCGACAGTCGCGCCCGGCTCAAGAACCCGAAGCGG
CTATACTGGCTCATCAGCGCCATCAACAACCCGTCGGCCGTCCACAACCTCGGAAACGGCCAGCCGGCAGTAAAG
CAGATGGGCGACTGGCTGAAGGAAATTTGCGAGGCGCAGGAGAAGCTCAACTCGCGCGACCGGCTGCAGCGCATC
GTGCGGGAGATGCTCCACATCAACCCCACGCAACGCATCACCATGGCCATGGTGTTGCAAGAGCTACAGGCGGAA
CAGACGGTGGCCGTCCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail