Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4164
Gene name
LocationContig_381:7051..7804
Strand+
Gene length (bp)753
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999549

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup147
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7960
Ophiocordyceps australis map64 (Brazil) OphauB2|840
Ophiocordyceps camponoti-floridani Ophcf2|02656
Ophiocordyceps camponoti-floridani Ophcf2|06464
Ophiocordyceps camponoti-rufipedis Ophun1|4164 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6322
Ophiocordyceps kimflemingae Ophio5|1791
Ophiocordyceps kimflemingae Ophio5|2231
Ophiocordyceps kimflemingae Ophio5|447
Ophiocordyceps subramaniannii Hirsu2|10000
Ophiocordyceps subramaniannii Hirsu2|2074
Ophiocordyceps subramaniannii Hirsu2|389

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4164
MKYDSAIMGLALTMPALVQAGESSLAELCADRCMDAFKACRNTPNVNMAQCNSDYTRCLGFSPFSGTVMATPTAC
SPSRISTSSASADATSTQAASKTCEDKFNACRSKPGANISTCSSEKAACLAAGRESTSSASYPTPTGKKDNGVKA
CEDKFNACRSKPGANISTCASERAACLAECAKKPAPTSSIKYSSSTTPPSTTAYASTSTYASTTASASPSPTIVY
VAGGVNMEPSLAYWTMGLGALMLLL*
Coding >Ophun1|4164
ATGAAGTACGATTCTGCCATCATGGGCCTGGCCCTCACAATGCCCGCTCTGGTGCAAGCCGGCGAGTCCTCTCTA
GCCGAACTATGCGCCGACAGGTGCATGGACGCCTTCAAGGCCTGCCGCAACACGCCCAACGTCAACATGGCCCAG
TGCAACTCGGACTACACCCGCTGCCTGGGCTTCAGCCCCTTTTCAGGCACCGTCATGGCGACGCCCACGGCCTGT
TCTCCGAGCAGGATATCCACCTCGTCCGCTTCTGCCGACGCAACCAGCACTCAGGCCGCATCCAAGACGTGCGAG
GACAAGTTCAACGCCTGCCGCAGCAAGCCCGGAGCCAACATCTCCACTTGCTCTTCAGAAAAGGCCGCCTGTCTC
GCCGCGGGCAGGGAGTCCACATCGTCTGCTTCTTACCCCACGCCAACCGGCAAGAAGGACAACGGGGTGAAGGCG
TGTGAGGACAAGTTCAATGCCTGCCGCAGCAAGCCAGGGGCCAACATCTCGACCTGCGCTTCAGAAAGGGCCGCT
TGTCTCGCCGAGTGCGCGAAGAAGCCGGCGCCTACCAGCAGCATCAAGTATAGCAGCAGCACGACGCCTCCCAGC
ACCACTGCGTACGCCAGCACTTCGACGTATGCCAGCACCACGGCGTCGGCCAGCCCGTCGCCCACCATCGTCTAC
GTCGCCGGCGGCGTGAACATGGAGCCCTCTCTCGCCTATTGGACCATGGGGCTGGGAGCGTTGATGCTGCTGCTG
TAG
Transcript >Ophun1|4164
ATGAAGTACGATTCTGCCATCATGGGCCTGGCCCTCACAATGCCCGCTCTGGTGCAAGCCGGCGAGTCCTCTCTA
GCCGAACTATGCGCCGACAGGTGCATGGACGCCTTCAAGGCCTGCCGCAACACGCCCAACGTCAACATGGCCCAG
TGCAACTCGGACTACACCCGCTGCCTGGGCTTCAGCCCCTTTTCAGGCACCGTCATGGCGACGCCCACGGCCTGT
TCTCCGAGCAGGATATCCACCTCGTCCGCTTCTGCCGACGCAACCAGCACTCAGGCCGCATCCAAGACGTGCGAG
GACAAGTTCAACGCCTGCCGCAGCAAGCCCGGAGCCAACATCTCCACTTGCTCTTCAGAAAAGGCCGCCTGTCTC
GCCGCGGGCAGGGAGTCCACATCGTCTGCTTCTTACCCCACGCCAACCGGCAAGAAGGACAACGGGGTGAAGGCG
TGTGAGGACAAGTTCAATGCCTGCCGCAGCAAGCCAGGGGCCAACATCTCGACCTGCGCTTCAGAAAGGGCCGCT
TGTCTCGCCGAGTGCGCGAAGAAGCCGGCGCCTACCAGCAGCATCAAGTATAGCAGCAGCACGACGCCTCCCAGC
ACCACTGCGTACGCCAGCACTTCGACGTATGCCAGCACCACGGCGTCGGCCAGCCCGTCGCCCACCATCGTCTAC
GTCGCCGGCGGCGTGAACATGGAGCCCTCTCTCGCCTATTGGACCATGGGGCTGGGAGCGTTGATGCTGCTGCTG
TAG
Gene >Ophun1|4164
ATGAAGTACGATTCTGCCATCATGGGCCTGGCCCTCACAATGCCCGCTCTGGTGCAAGCCGGCGAGTCCTCTCTA
GCCGAACTATGCGCCGACAGGTGCATGGACGCCTTCAAGGCCTGCCGCAACACGCCCAACGTCAACATGGCCCAG
TGCAACTCGGACTACACCCGCTGCCTGGGCTTCAGCCCCTTTTCAGGCACCGTCATGGCGACGCCCACGGCCTGT
TCTCCGAGCAGGATATCCACCTCGTCCGCTTCTGCCGACGCAACCAGCACTCAGGCCGCATCCAAGACGTGCGAG
GACAAGTTCAACGCCTGCCGCAGCAAGCCCGGAGCCAACATCTCCACTTGCTCTTCAGAAAAGGCCGCCTGTCTC
GCCGCGGGCAGGGAGTCCACATCGTCTGCTTCTTACCCCACGCCAACCGGCAAGAAGGACAACGGGGTGAAGGCG
TGTGAGGACAAGTTCAATGCCTGCCGCAGCAAGCCAGGGGCCAACATCTCGACCTGCGCTTCAGAAAGGGCCGCT
TGTCTCGCCGAGTGCGCGAAGAAGCCGGCGCCTACCAGCAGCATCAAGTATAGCAGCAGCACGACGCCTCCCAGC
ACCACTGCGTACGCCAGCACTTCGACGTATGCCAGCACCACGGCGTCGGCCAGCCCGTCGCCCACCATCGTCTAC
GTCGCCGGCGGCGTGAACATGGAGCCCTCTCTCGCCTATTGGACCATGGGGCTGGGAGCGTTGATGCTGCTGCTG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail