Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4157
Gene name
LocationContig_380:8488..10255
Strand-
Gene length (bp)1767
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.9E-37 74 461
PF00083 Sugar_tr Sugar (and other) transporter 2.3E-17 101 257
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.2E-07 76 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 43 508 7.0E-84
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 52 508 2.0E-83
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 47 506 2.0E-82
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 49 508 4.0E-76
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 51 506 1.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 43 508 7.0E-84
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 52 508 2.0E-83
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 47 506 2.0E-82
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 49 508 4.0E-76
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 51 506 1.0E-74
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 4 506 6.0E-74
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 41 507 3.0E-73
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 47 504 5.0E-71
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 22 506 8.0E-71
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 47 504 2.0E-69
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 2 508 5.0E-69
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 5 505 1.0E-65
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 54 506 1.0E-60
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 6 508 2.0E-59
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 54 508 3.0E-57
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 52 508 4.0E-57
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 51 485 2.0E-54
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 53 508 4.0E-54
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 52 526 3.0E-52
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 54 508 7.0E-50
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 54 508 9.0E-50
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 54 511 1.0E-42
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 5 508 2.0E-42
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 54 511 2.0E-42
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 58 511 2.0E-37
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 2 520 8.0E-37
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 54 513 5.0E-33
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 55 511 3.0E-32
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 91 286 3.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 55 274 1.0E-14
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 55 278 6.0E-13
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 91 523 2.0E-12
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 378 511 3.0E-11
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 112 258 2.0E-09
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 65 245 2.0E-09
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 62 270 5.0E-09
sp|Q797E3|PBUE_BACSU Purine efflux pump PbuE OS=Bacillus subtilis (strain 168) GN=pbuE PE=1 SV=1 87 211 7.0E-09
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 65 349 1.0E-08
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 54 244 2.0E-08
sp|Q9GQQ0|SPIN_DROME Protein spinster OS=Drosophila melanogaster GN=spin PE=1 SV=1 87 244 3.0E-08
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 109 246 3.0E-08
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 65 229 3.0E-08
sp|Q0GQS6|PBUE_BACAM Purine efflux pump PbuE OS=Bacillus amyloliquefaciens GN=pbuE PE=1 SV=1 87 211 1.0E-07
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 54 272 1.0E-07
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 54 250 1.0E-07
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 109 246 2.0E-07
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 109 246 2.0E-07
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 109 246 2.0E-07
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 109 246 2.0E-07
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 109 246 2.0E-07
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 109 246 2.0E-07
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 109 246 2.0E-07
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 109 246 2.0E-07
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 77 255 4.0E-07
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 64 226 1.0E-06
sp|Q5XGK0|SPNS1_XENLA Protein spinster homolog 1 OS=Xenopus laevis GN=spns1 PE=2 SV=1 86 227 2.0E-06
sp|P76628|YGAY_ECOLI Putative uncharacterized transporter YgaY OS=Escherichia coli (strain K12) GN=ygaY PE=5 SV=2 91 253 2.0E-06
sp|Q8X4V6|YGAY_ECO57 Uncharacterized transporter YgaY OS=Escherichia coli O157:H7 GN=ygaY PE=3 SV=1 91 253 2.0E-06
sp|O31577|YFHI_BACSU Uncharacterized MFS-type transporter YfhI OS=Bacillus subtilis (strain 168) GN=yfhI PE=3 SV=1 78 244 3.0E-06
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 58 228 4.0E-06
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 63 281 4.0E-06
sp|P57648|Y588_BUCAI Uncharacterized transporter BU588 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU588 PE=3 SV=1 71 222 5.0E-06
sp|A2SWM2|SPNS2_DANRE Protein spinster homolog 2 OS=Danio rerio GN=spns2 PE=1 SV=2 87 239 6.0E-06
sp|B0JZE1|SPNS2_XENTR Protein spinster homolog 2 OS=Xenopus tropicalis GN=spns2 PE=2 SV=1 48 262 6.0E-06
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 64 229 6.0E-06
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 82 274 7.0E-06
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 64 229 7.0E-06
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 62 260 7.0E-06
sp|P71369|Y1104_HAEIN Putative metabolite transport protein HI_1104 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1104 PE=3 SV=1 91 268 8.0E-06
sp|A2CER7|SPNS3_DANRE Protein spinster homolog 3 OS=Danio rerio GN=spns3 PE=2 SV=1 49 228 9.0E-06
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 126 229 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 105 127 22
3 134 156 22
4 192 214 22
5 221 243 22
6 303 325 22
7 338 360 22
8 380 402 22
9 409 431 22
10 473 495 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4157
MDRIETQALESKTAIAHEAAVPPTPATRHAELKDGTYDGVYFNKDGFVDYAPGDPEFPQNWPLLRRIYVTSSVVF
LVFNATFASSAISGCLPSVIKRFHVSPVVAGLTVTVFLLGYCAGPLFFAPLSEIYGRRWIFYCTFSLYFVFNFLC
AWAPNYAALLIGRAITGTLVSAPLSNAPGVIADVWNPIERGTAMAGFAASVWCGSALGPVVGGFLQLKKNWQWVF
YVQIWLAAGSLFLMPLIPETHAPTILRHKAKKLRQSDNPMFKDVKAPADATDRRLGPALKIAVTRPFVILFDPIS
FACAIYLSVIYTLLYMLFAIYPFIFGRKRGWNAGVSKLPLLGTIVGCFLGAGLIVWETQRRGKKIKAGLVKPTDF
TAEDRLPLAMGGGVGFAICMFTFAWTGEFNSIPWIIPTIAGGLLSCCLLLVFVAFLNYIVDSYMQFAASAIAANT
IMRSACGSAAPLFTPQMFAALGVGVGGSIIGAVAVVLAAIPFLFYRYGKGIRERSKFSPSRAMAAKKPPEEEEAA
VMTAYEAYAKSMEGLVDQDGNIPHYEDPWRHDSFTGEWPLTR*
Coding >Ophun1|4157
ATGGATCGAATCGAAACCCAAGCTCTAGAGAGCAAGACGGCCATTGCTCATGAAGCAGCCGTTCCACCAACACCG
GCTACCAGACACGCCGAGCTCAAGGACGGAACGTACGACGGCGTCTACTTCAACAAGGATGGCTTCGTTGATTAC
GCGCCAGGAGACCCAGAGTTCCCGCAGAACTGGCCGCTGTTAAGACGCATCTACGTCACGTCTTCTGTCGTCTTC
CTCGTCTTCAACGCCACCTTTGCCTCGAGCGCCATCAGCGGATGTCTCCCGTCGGTGATTAAGAGGTTTCACGTC
TCGCCCGTTGTTGCTGGTCTTACCGTCACCGTCTTCCTGCTCGGCTACTGCGCTGGACCTCTCTTCTTTGCGCCG
TTGAGTGAAATCTACGGTCGACGCTGGATCTTCTATTGCACCTTTTCTTTGTACTTTGTCTTCAACTTCCTTTGC
GCCTGGGCTCCCAACTATGCCGCTCTCCTCATCGGAAGGGCCATCACCGGCACTCTGGTCTCGGCGCCGCTCAGC
AACGCCCCCGGCGTGATTGCCGACGTCTGGAACCCCATCGAGCGAGGAACGGCCATGGCAGGCTTCGCGGCCTCG
GTCTGGTGCGGTTCCGCGCTGGGGCCAGTTGTTGGTGGTTTCTTGCAACTGAAGAAGAACTGGCAATGGGTCTTT
TACGTTCAGATCTGGCTCGCGGCCGGCTCTCTTTTCCTCATGCCTCTTATCCCCGAGACTCACGCGCCGACGATC
CTGCGACACAAGGCCAAGAAGCTGCGACAGTCAGACAACCCCATGTTCAAGGACGTCAAGGCACCGGCCGACGCG
ACGGATCGCAGACTCGGTCCGGCGCTCAAGATCGCCGTCACGCGGCCGTTTGTCATTCTCTTTGATCCCATTTCC
TTTGCCTGCGCCATTTACCTGTCCGTCATTTACACGCTGTTGTACATGCTGTTCGCCATTTACCCCTTTATCTTT
GGGAGGAAGCGCGGGTGGAATGCTGGTGTCAGCAAGCTGCCACTCCTGGGAACCATCGTCGGCTGTTTCCTGGGG
GCGGGCTTGATCGTGTGGGAGACGCAGAGGCGTGGAAAGAAGATCAAGGCAGGACTGGTCAAGCCAACGGACTTT
ACTGCGGAAGATCGACTTCCGCTCGCCATGGGCGGAGGCGTGGGCTTTGCCATCTGCATGTTTACCTTTGCCTGG
ACGGGCGAGTTCAACTCAATTCCGTGGATCATCCCCACCATCGCAGGCGGTCTCCTCTCGTGCTGTCTTCTCCTC
GTCTTTGTCGCTTTCCTCAACTACATTGTCGACAGTTACATGCAGTTTGCAGCCTCGGCCATCGCAGCCAACACC
ATTATGCGATCAGCCTGCGGCTCTGCAGCGCCTCTGTTCACACCGCAAATGTTCGCGGCACTGGGTGTCGGCGTC
GGGGGCAGCATCATCGGTGCGGTCGCTGTGGTGTTGGCCGCGATACCCTTCCTCTTTTACAGGTACGGCAAGGGC
ATCAGGGAACGAAGCAAGTTCTCGCCAAGCAGGGCCATGGCGGCCAAGAAGCCGCCGGAGGAGGAGGAGGCTGCA
GTCATGACGGCGTACGAGGCCTACGCCAAGTCGATGGAGGGCCTCGTCGACCAAGACGGCAATATCCCTCACTAT
GAGGATCCTTGGCGGCACGACAGCTTTACCGGAGAGTGGCCGCTGACCCGATAG
Transcript >Ophun1|4157
ATGGATCGAATCGAAACCCAAGCTCTAGAGAGCAAGACGGCCATTGCTCATGAAGCAGCCGTTCCACCAACACCG
GCTACCAGACACGCCGAGCTCAAGGACGGAACGTACGACGGCGTCTACTTCAACAAGGATGGCTTCGTTGATTAC
GCGCCAGGAGACCCAGAGTTCCCGCAGAACTGGCCGCTGTTAAGACGCATCTACGTCACGTCTTCTGTCGTCTTC
CTCGTCTTCAACGCCACCTTTGCCTCGAGCGCCATCAGCGGATGTCTCCCGTCGGTGATTAAGAGGTTTCACGTC
TCGCCCGTTGTTGCTGGTCTTACCGTCACCGTCTTCCTGCTCGGCTACTGCGCTGGACCTCTCTTCTTTGCGCCG
TTGAGTGAAATCTACGGTCGACGCTGGATCTTCTATTGCACCTTTTCTTTGTACTTTGTCTTCAACTTCCTTTGC
GCCTGGGCTCCCAACTATGCCGCTCTCCTCATCGGAAGGGCCATCACCGGCACTCTGGTCTCGGCGCCGCTCAGC
AACGCCCCCGGCGTGATTGCCGACGTCTGGAACCCCATCGAGCGAGGAACGGCCATGGCAGGCTTCGCGGCCTCG
GTCTGGTGCGGTTCCGCGCTGGGGCCAGTTGTTGGTGGTTTCTTGCAACTGAAGAAGAACTGGCAATGGGTCTTT
TACGTTCAGATCTGGCTCGCGGCCGGCTCTCTTTTCCTCATGCCTCTTATCCCCGAGACTCACGCGCCGACGATC
CTGCGACACAAGGCCAAGAAGCTGCGACAGTCAGACAACCCCATGTTCAAGGACGTCAAGGCACCGGCCGACGCG
ACGGATCGCAGACTCGGTCCGGCGCTCAAGATCGCCGTCACGCGGCCGTTTGTCATTCTCTTTGATCCCATTTCC
TTTGCCTGCGCCATTTACCTGTCCGTCATTTACACGCTGTTGTACATGCTGTTCGCCATTTACCCCTTTATCTTT
GGGAGGAAGCGCGGGTGGAATGCTGGTGTCAGCAAGCTGCCACTCCTGGGAACCATCGTCGGCTGTTTCCTGGGG
GCGGGCTTGATCGTGTGGGAGACGCAGAGGCGTGGAAAGAAGATCAAGGCAGGACTGGTCAAGCCAACGGACTTT
ACTGCGGAAGATCGACTTCCGCTCGCCATGGGCGGAGGCGTGGGCTTTGCCATCTGCATGTTTACCTTTGCCTGG
ACGGGCGAGTTCAACTCAATTCCGTGGATCATCCCCACCATCGCAGGCGGTCTCCTCTCGTGCTGTCTTCTCCTC
GTCTTTGTCGCTTTCCTCAACTACATTGTCGACAGTTACATGCAGTTTGCAGCCTCGGCCATCGCAGCCAACACC
ATTATGCGATCAGCCTGCGGCTCTGCAGCGCCTCTGTTCACACCGCAAATGTTCGCGGCACTGGGTGTCGGCGTC
GGGGGCAGCATCATCGGTGCGGTCGCTGTGGTGTTGGCCGCGATACCCTTCCTCTTTTACAGGTACGGCAAGGGC
ATCAGGGAACGAAGCAAGTTCTCGCCAAGCAGGGCCATGGCGGCCAAGAAGCCGCCGGAGGAGGAGGAGGCTGCA
GTCATGACGGCGTACGAGGCCTACGCCAAGTCGATGGAGGGCCTCGTCGACCAAGACGGCAATATCCCTCACTAT
GAGGATCCTTGGCGGCACGACAGCTTTACCGGAGAGTGGCCGCTGACCCGATAG
Gene >Ophun1|4157
ATGGATCGAATCGAAACCCAAGCTCTAGAGAGCAAGACGGCCATTGCTCATGAAGCAGCCGTTCCACCAACACCG
GCTACCAGACACGCCGAGCTCAAGGACGGAACGTACGACGGCGTCTACTTCAACAAGGATGGCTTCGTTGATTAC
GCGCCAGGAGACCCAGAGTTCCCGCAGAACTGGCCGCTGTTAAGACGCATCTACGTCACGTCTTCTGTCGTCTTC
CTCGTCTTCAACGCCACCTTTGCCTCGAGCGCCATCAGCGGATGTCTCCCGTCGGTGATTAAGAGGTTTCACGTC
TCGCCCGTTGTTGCTGGTCTTACCGTCACCGTCTTCCTGCTCGGCTACTGCGCTGGACCTCTCTTCTTTGCGCCG
TTGAGTGAAATCTACGGTCGACGCTGGATCTTCTATTGCACCTTTTCTTTGTACTTTGTCTTCAACTTCCTTTGC
GCCTGGGCTCCCAACTATGCCGCTCTCCTCATCGGAAGGGCCATCACCGGCACTCTGGTCTCGGCGCCGCTCAGC
AACGCCCCCGGCGTGATTGCCGACGTCTGGAACCCCATCGAGCGAGGAACGGCCATGGCAGGCTTCGCGGCCTCG
GTCTGGTGCGGTTCCGCGCTGGGGCCAGTTGTTGGTGGTTTCTTGCAACTGAAGAAGAACTGGCAATGGGTCTTT
TACGTTCAGATCTGGCTCGCGGCCGGCTCTCTTTTCCTCATGCCTCTTATCCCCGAGACTCACGCGCCGACGATC
CTGCGACACAAGGCCAAGAAGCTGCGACAGTCAGACAACCCCATGTTCAAGGACGTCAAGGCACCGGCCGACGCG
ACGGATCGCAGACTCGGTCCGGCGCTCAAGATCGCCGTCACGCGGCCGTTTGTCATTCTCTTTGATCCCATTTCC
TTTGCCTGCGCCATTTACCTGTCCGTCATTTACACGCTGTTGTACATGCTGTTCGCCATTTACCCCTTTATCTTT
GGGAGGAAGCGCGGGTGGAATGCTGGTGTCAGCAAGCTGCCACTCCTGGGAACCATCGTCGGCTGTTTCCTGGGG
GCGGGCTTGATCGTGTGGGAGACGCAGAGGCGTGGAAAGAAGATCAAGGCAGGACTGGTCAAGCCAACGGACTTT
ACTGCGGAAGATCGACTTCCGCTCGCCATGGGCGGAGGCGTGGGCTTTGCCATCTGCATGTTTACCTTTGCCTGG
ACGGGCGAGTTCAAGTAAGTTGACCTTGTCAGATGAACAGCCACCGCGAGACGAACATGAAGCTGACCTGTATCA
AGCTCAATTCCGTGGATCATCCCCACCATCGCAGGCGGTCTCCTCTCGTGCTGTCTTCTCCTCGTCTTTGTCGCT
TTCCTCAACTACATTGTCGACAGTTACATGCAGTTTGCAGCCTCGGCCATCGCAGCCAACACCATTATGCGATCA
GCCTGCGGCTCTGCAGCGCCTCTGTTCACACCGCAAATGTTCGCGGCACTGGGTGTCGGCGTCGGGGGCAGCATC
ATCGGTGCGGTCGCTGTGGTGTTGGCCGCGATACCCTTCCTCTTTTACAGGTACGGCAAGGGCATCAGGGAACGA
AGCAAGTTCTCGCCAAGCAGGGCCATGGCGGCCAAGAAGCCGCCGGAGGAGGAGGAGGCTGCAGTCATGACGGCG
TACGAGGCCTACGCCAAGTCGATGGAGGGCCTCGTCGACCAAGACGGCAATATCCCTCACTATGAGGATCCTTGG
CGGCACGACAGCTTTACCGGAGAGTGGCCGCTGACCCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail