Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4155
Gene name
LocationContig_380:18..3365
Strand-
Gene length (bp)3347
Transcript length (bp)3216
Coding sequence length (bp)3216
Protein length (aa) 1072

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6H236|PEG3_BOVIN Paternally-expressed gene 3 protein OS=Bos taurus GN=PEG3 PE=2 SV=1 402 1039 3.0E-29
sp|Q6H236|PEG3_BOVIN Paternally-expressed gene 3 protein OS=Bos taurus GN=PEG3 PE=2 SV=1 246 607 7.0E-16
sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall protein OS=Medicago sativa GN=PRP PE=2 SV=1 443 649 2.0E-12
sp|P08012|PRP1_SOYBN Repetitive proline-rich cell wall protein 1 OS=Glycine max GN=PRP1 PE=3 SV=1 338 524 2.0E-12
sp|Q26264|SM41_HEMPU 41 kDa spicule matrix protein OS=Hemicentrotus pulcherrimus PE=2 SV=1 848 981 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6H236|PEG3_BOVIN Paternally-expressed gene 3 protein OS=Bos taurus GN=PEG3 PE=2 SV=1 402 1039 3.0E-29
sp|Q6H236|PEG3_BOVIN Paternally-expressed gene 3 protein OS=Bos taurus GN=PEG3 PE=2 SV=1 246 607 7.0E-16
sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall protein OS=Medicago sativa GN=PRP PE=2 SV=1 443 649 2.0E-12
sp|P08012|PRP1_SOYBN Repetitive proline-rich cell wall protein 1 OS=Glycine max GN=PRP1 PE=3 SV=1 338 524 2.0E-12
sp|Q26264|SM41_HEMPU 41 kDa spicule matrix protein OS=Hemicentrotus pulcherrimus PE=2 SV=1 848 981 3.0E-12
sp|P08012|PRP1_SOYBN Repetitive proline-rich cell wall protein 1 OS=Glycine max GN=PRP1 PE=3 SV=1 400 600 5.0E-12
sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall protein OS=Medicago sativa GN=PRP PE=2 SV=1 424 649 6.0E-12
sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall protein OS=Medicago sativa GN=PRP PE=2 SV=1 271 481 1.0E-11
sp|P08012|PRP1_SOYBN Repetitive proline-rich cell wall protein 1 OS=Glycine max GN=PRP1 PE=3 SV=1 277 480 6.0E-11
sp|Q5XGC9|SRFB1_XENTR Serum response factor-binding protein 1 OS=Xenopus tropicalis GN=srfbp1 PE=2 SV=1 477 647 1.0E-10
sp|Q40375|PRP2_MEDTR Repetitive proline-rich cell wall protein 2 OS=Medicago truncatula GN=PRP2 PE=2 SV=1 449 786 1.0E-10
sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall protein OS=Medicago sativa GN=PRP PE=2 SV=1 360 562 2.0E-10
sp|Q43564|PRP1_MEDTR Repetitive proline-rich cell wall protein 1 OS=Medicago truncatula GN=PRP1 PE=2 SV=1 443 649 2.0E-10
sp|Q43564|PRP1_MEDTR Repetitive proline-rich cell wall protein 1 OS=Medicago truncatula GN=PRP1 PE=2 SV=1 424 606 3.0E-10
sp|Q43564|PRP1_MEDTR Repetitive proline-rich cell wall protein 1 OS=Medicago truncatula GN=PRP1 PE=2 SV=1 370 552 4.0E-10
sp|Q25460|FP1_MYTED Adhesive plaque matrix protein (Fragment) OS=Mytilus edulis GN=FP1 PE=1 SV=1 336 1059 7.0E-10
sp|Q25460|FP1_MYTED Adhesive plaque matrix protein (Fragment) OS=Mytilus edulis GN=FP1 PE=1 SV=1 159 963 4.0E-09
sp|Q5XGC9|SRFB1_XENTR Serum response factor-binding protein 1 OS=Xenopus tropicalis GN=srfbp1 PE=2 SV=1 618 786 9.0E-09
sp|Q40375|PRP2_MEDTR Repetitive proline-rich cell wall protein 2 OS=Medicago truncatula GN=PRP2 PE=2 SV=1 400 733 1.0E-08
sp|Q43564|PRP1_MEDTR Repetitive proline-rich cell wall protein 1 OS=Medicago truncatula GN=PRP1 PE=2 SV=1 239 404 2.0E-08
sp|Q10172|PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan1 PE=1 SV=1 848 1045 3.0E-08
sp|P08012|PRP1_SOYBN Repetitive proline-rich cell wall protein 1 OS=Glycine max GN=PRP1 PE=3 SV=1 536 743 4.0E-08
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 904 1033 7.0E-08
sp|Q43564|PRP1_MEDTR Repetitive proline-rich cell wall protein 1 OS=Medicago truncatula GN=PRP1 PE=2 SV=1 563 786 7.0E-08
sp|Q10172|PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan1 PE=1 SV=1 848 1045 1.0E-07
sp|Q25460|FP1_MYTED Adhesive plaque matrix protein (Fragment) OS=Mytilus edulis GN=FP1 PE=1 SV=1 212 1010 2.0E-07
sp|P08012|PRP1_SOYBN Repetitive proline-rich cell wall protein 1 OS=Glycine max GN=PRP1 PE=3 SV=1 212 388 2.0E-07
sp|P11994|SM50_STRPU 50 kDa spicule matrix protein OS=Strongylocentrotus purpuratus GN=SM50 PE=2 SV=2 917 1040 3.0E-07
sp|P08012|PRP1_SOYBN Repetitive proline-rich cell wall protein 1 OS=Glycine max GN=PRP1 PE=3 SV=1 689 864 3.0E-07
sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall protein OS=Medicago sativa GN=PRP PE=2 SV=1 590 816 8.0E-07
sp|Q13117|DAZ2_HUMAN Deleted in azoospermia protein 2 OS=Homo sapiens GN=DAZ2 PE=1 SV=3 271 627 1.0E-06
sp|Q13117|DAZ2_HUMAN Deleted in azoospermia protein 2 OS=Homo sapiens GN=DAZ2 PE=1 SV=3 337 662 2.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 961 1043 5.0E-06
sp|Q40375|PRP2_MEDTR Repetitive proline-rich cell wall protein 2 OS=Medicago truncatula GN=PRP2 PE=2 SV=1 536 884 8.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999213

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4526
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06423
Ophiocordyceps camponoti-rufipedis Ophun1|1495
Ophiocordyceps camponoti-rufipedis Ophun1|4155 (this protein)
Ophiocordyceps kimflemingae Ophio5|6592
Ophiocordyceps kimflemingae Ophio5|7520
Ophiocordyceps subramaniannii Hirsu2|946

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4155
MHFLIAPLILGAAATAAEHHNARESGSVVPVAEMRRDMAAVAEKGEAREETPLMMNSAKFRNNKRQDGYGSGSGD
GYGGSGDGYGGNAGGDAGGNAGGNAGGNSANGGYGGNTGYGDNSANGGNGADNGYGDVPTYETPSDADTDQSFAY
SASDNSPSYGNGGSNPPSYGNDGAGNPNYGNDGSNPLAPGTPIDLMYNMLNEPPYVTNDGKPTYAENMGSNEDYG
TPSYGSSSDEQPAYTEDSSYQTPTYEQPAYTEDSSYQTPTYEQPAYTEEPTYEEPAYTEDPAYGSPSYEQPEQPA
YQDTSYEQPAYTEEPTYEQPAYTEDSSYQTPTYEQPSYTEEPTYEQPAYTEEPTYEEPAYTEDPAYGSPSYEQPE
QPAYQDSSYEQPAYTEDSSYQTPTYEEPAYTEEPAYDTPTYEQPAYNGQEPSYQTPTYEEPAYTEEPSYEQPAYT
EEPSYQTPTYEEPAYTEEPAYDTPTYEQPAYNGQEPSYQTPTYEEPAYTEEPSYEQPAYTEEPSYQTPTYEEPAY
TEEPSYEEPAYTEDSSYQTPTYEEPAYTEEPSYEQPAYTEDSSYQTPTYEEPAYTEEPSYEQPAYTEEPSYQTPT
YEEPAYTEEPSYDTPTYEQPAYNGQEPSYQTPTYEEPSYETPTYEAPVYTEVPADQVYENTWEGPPFTDPDYTTT
YVQYTPTPTNEPAYTETPSYEEPAYTETPSYEEPAYTETPSYEEPAYTETPSYEEPAYTETPSYEEPAYTETPSY
EEPAYTETPSYEEPTYEQPTYNEPSYQQPAYEEPAYTETPTYEEPAYTETPDPTYSPGYDEPSYEPEQPDYTEEP
EQPAYTEEPGYGSPSYSGSSGGSGYDDPIYQEPSYEQPTYTGYDEPSYSSAPTYDQPSYPQEPSYPEQPSYEPEQ
PGYPQEPSYQPEEPAYTEQPSYEPEQPGYPQEPSYQPEEPAYTEQPSYEPEQPSYPQEPSYEPEQPSYEPQQPGY
PQEPSYEPEQPSYEPEQPGYPQEPNYPEQPSYEPEQPSYPQEPSYEPEQPSYEPEQPGYPQEPSYEPEQPSPATP
RSRAMSLSSPPQLPPGAELRA*
Coding >Ophun1|4155
ATGCACTTCTTAATCGCCCCCTTGATTTTGGGCGCCGCTGCTACGGCAGCCGAGCACCATAATGCTCGGGAGTCG
GGCTCCGTCGTGCCCGTCGCCGAGATGCGCAGGGATATGGCTGCCGTGGCTGAGAAGGGTGAGGCTCGTGAGGAG
ACGCCCTTGATGATGAACTCGGCCAAGTTCCGCAACAACAAGAGGCAGGATGGCTATGGCTCGGGGAGCGGTGAC
GGCTATGGTGGCAGCGGTGACGGCTACGGGGGGAACGCCGGTGGTGACGCCGGTGGTAACGCCGGTGGCAACGCC
GGTGGCAACTCGGCCAACGGCGGATACGGAGGAAACACCGGCTACGGAGACAACTCGGCCAACGGCGGCAACGGA
GCCGACAACGGCTATGGCGATGTCCCCACCTACGAGACTCCCTCCGACGCCGACACCGACCAGTCCTTCGCGTAC
AGCGCCTCCGACAACAGCCCGAGCTACGGCAACGGAGGCTCCAACCCCCCGAGCTATGGCAACGACGGCGCCGGC
AACCCGAACTACGGCAACGACGGCTCCAACCCCCTCGCTCCCGGAACGCCCATCGATCTCATGTACAACATGCTG
AACGAGCCTCCGTACGTTACCAACGACGGAAAGCCTACCTACGCCGAAAACATGGGTTCCAATGAGGATTACGGC
ACGCCGTCGTACGGGTCGTCTTCTGATGAGCAGCCGGCTTACACCGAGGACTCTTCTTACCAGACGCCTACGTAT
GAGCAGCCGGCCTACACTGAGGACTCCTCCTACCAGACGCCTACGTACGAGCAGCCGGCCTACACCGAGGAGCCG
ACCTACGAGGAGCCGGCTTACACCGAGGACCCTGCCTACGGGTCTCCTTCTTACGAGCAGCCTGAGCAGCCTGCC
TACCAGGATACGTCTTACGAGCAGCCGGCCTACACCGAGGAGCCGACCTACGAGCAGCCCGCTTACACCGAGGAC
TCTTCTTACCAGACGCCTACGTACGAGCAGCCGTCTTACACCGAGGAGCCTACGTACGAGCAGCCAGCCTACACC
GAGGAGCCGACCTACGAGGAGCCGGCTTACACCGAGGACCCTGCCTACGGGTCTCCTTCTTACGAGCAGCCTGAG
CAGCCTGCCTACCAGGATTCGTCTTACGAGCAGCCTGCCTACACCGAGGATTCTTCTTACCAGACGCCTACGTAC
GAGGAGCCTGCTTATACCGAAGAGCCTGCCTACGACACGCCTACGTACGAGCAGCCGGCTTACAACGGCCAGGAG
CCTTCCTACCAGACGCCCACGTACGAGGAGCCCGCCTACACCGAGGAGCCAAGCTACGAGCAGCCGGCCTACACC
GAGGAGCCTTCATACCAGACCCCTACGTATGAGGAGCCTGCTTATACCGAGGAGCCTGCCTACGACACGCCTACG
TATGAGCAGCCAGCTTACAACGGCCAGGAGCCTTCCTACCAGACGCCCACGTACGAGGAGCCTGCCTACACCGAG
GAGCCAAGCTACGAGCAGCCGGCCTACACCGAGGAGCCTTCATACCAGACGCCTACGTACGAGGAGCCTGCCTAC
ACCGAGGAGCCAAGCTACGAGGAGCCCGCCTATACCGAGGATTCCTCTTACCAGACGCCCACGTACGAGGAGCCC
GCCTACACCGAGGAGCCAAGCTACGAGCAGCCGGCCTACACCGAGGATTCCTCTTACCAGACGCCCACATATGAG
GAGCCTGCTTATACCGAAGAGCCTAGCTACGAGCAGCCGGCCTACACCGAGGAGCCTTCATACCAGACCCCTACG
TATGAGGAGCCTGCTTACACCGAGGAGCCTAGCTACGACACGCCTACGTACGAGCAGCCGGCTTACAACGGCCAG
GAGCCCTCGTACCAGACCCCCACGTACGAGGAGCCTTCTTATGAGACGCCTACCTACGAAGCGCCCGTCTACACC
GAGGTTCCCGCCGACCAGGTCTACGAGAACACTTGGGAGGGCCCGCCATTCACGGACCCGGACTACACGACTACG
TACGTCCAGTACACGCCGACGCCCACCAACGAGCCGGCCTACACCGAGACACCGTCTTACGAGGAGCCGGCTTAC
ACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACA
CCGTCTTACGAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACACCGTCCTAC
GAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGACGTACGAGCAGCCTACGTACAACGAGCCTTCC
TACCAGCAGCCGGCCTATGAGGAGCCTGCTTACACCGAGACGCCGACCTACGAGGAGCCCGCTTACACCGAGACT
CCGGATCCCACGTACTCTCCAGGATATGACGAGCCCAGCTACGAGCCGGAGCAGCCTGATTACACCGAGGAGCCG
GAGCAACCTGCCTACACCGAGGAGCCTGGCTATGGCTCGCCGTCTTACTCTGGGTCGTCTGGTGGATCAGGTTAC
GATGATCCTATCTACCAGGAGCCCTCCTACGAGCAGCCGACTTACACTGGCTACGACGAGCCTTCTTACTCTTCT
GCTCCGACTTACGATCAGCCCAGCTACCCCCAGGAGCCCAGCTACCCCGAGCAGCCCTCGTATGAGCCGGAACAG
CCTGGCTACCCGCAGGAGCCCAGCTACCAGCCCGAGGAGCCGGCCTACACGGAGCAGCCCTCTTACGAGCCTGAG
CAGCCTGGCTACCCGCAAGAGCCCAGCTACCAGCCCGAGGAGCCGGCTTACACGGAGCAGCCTTCATACGAGCCT
GAGCAGCCCAGCTACCCCCAGGAACCCAGCTACGAGCCGGAGCAGCCCTCGTACGAGCCCCAGCAGCCTGGTTAC
CCCCAGGAGCCGAGCTACGAGCCCGAGCAGCCCTCGTATGAGCCGGAACAGCCTGGCTACCCGCAGGAGCCCAAC
TACCCCGAGCAGCCCTCTTATGAGCCTGAGCAGCCGTCTTACCCCCAGGAGCCTTCCTACGAGCCGGAACAGCCC
TCCTACGAGCCTGAGCAGCCTGGATACCCCCAGGAGCCGAGCTACGAGCCTGAGCAGCCCTCCCCAGCTACCCCC
AGGAGCCGAGCTATGAGCCTGAGCAGCCCTCCCCAGCTACCCCCAGGAGCCGAGCTACGAGCCTGA
Transcript >Ophun1|4155
ATGCACTTCTTAATCGCCCCCTTGATTTTGGGCGCCGCTGCTACGGCAGCCGAGCACCATAATGCTCGGGAGTCG
GGCTCCGTCGTGCCCGTCGCCGAGATGCGCAGGGATATGGCTGCCGTGGCTGAGAAGGGTGAGGCTCGTGAGGAG
ACGCCCTTGATGATGAACTCGGCCAAGTTCCGCAACAACAAGAGGCAGGATGGCTATGGCTCGGGGAGCGGTGAC
GGCTATGGTGGCAGCGGTGACGGCTACGGGGGGAACGCCGGTGGTGACGCCGGTGGTAACGCCGGTGGCAACGCC
GGTGGCAACTCGGCCAACGGCGGATACGGAGGAAACACCGGCTACGGAGACAACTCGGCCAACGGCGGCAACGGA
GCCGACAACGGCTATGGCGATGTCCCCACCTACGAGACTCCCTCCGACGCCGACACCGACCAGTCCTTCGCGTAC
AGCGCCTCCGACAACAGCCCGAGCTACGGCAACGGAGGCTCCAACCCCCCGAGCTATGGCAACGACGGCGCCGGC
AACCCGAACTACGGCAACGACGGCTCCAACCCCCTCGCTCCCGGAACGCCCATCGATCTCATGTACAACATGCTG
AACGAGCCTCCGTACGTTACCAACGACGGAAAGCCTACCTACGCCGAAAACATGGGTTCCAATGAGGATTACGGC
ACGCCGTCGTACGGGTCGTCTTCTGATGAGCAGCCGGCTTACACCGAGGACTCTTCTTACCAGACGCCTACGTAT
GAGCAGCCGGCCTACACTGAGGACTCCTCCTACCAGACGCCTACGTACGAGCAGCCGGCCTACACCGAGGAGCCG
ACCTACGAGGAGCCGGCTTACACCGAGGACCCTGCCTACGGGTCTCCTTCTTACGAGCAGCCTGAGCAGCCTGCC
TACCAGGATACGTCTTACGAGCAGCCGGCCTACACCGAGGAGCCGACCTACGAGCAGCCCGCTTACACCGAGGAC
TCTTCTTACCAGACGCCTACGTACGAGCAGCCGTCTTACACCGAGGAGCCTACGTACGAGCAGCCAGCCTACACC
GAGGAGCCGACCTACGAGGAGCCGGCTTACACCGAGGACCCTGCCTACGGGTCTCCTTCTTACGAGCAGCCTGAG
CAGCCTGCCTACCAGGATTCGTCTTACGAGCAGCCTGCCTACACCGAGGATTCTTCTTACCAGACGCCTACGTAC
GAGGAGCCTGCTTATACCGAAGAGCCTGCCTACGACACGCCTACGTACGAGCAGCCGGCTTACAACGGCCAGGAG
CCTTCCTACCAGACGCCCACGTACGAGGAGCCCGCCTACACCGAGGAGCCAAGCTACGAGCAGCCGGCCTACACC
GAGGAGCCTTCATACCAGACCCCTACGTATGAGGAGCCTGCTTATACCGAGGAGCCTGCCTACGACACGCCTACG
TATGAGCAGCCAGCTTACAACGGCCAGGAGCCTTCCTACCAGACGCCCACGTACGAGGAGCCTGCCTACACCGAG
GAGCCAAGCTACGAGCAGCCGGCCTACACCGAGGAGCCTTCATACCAGACGCCTACGTACGAGGAGCCTGCCTAC
ACCGAGGAGCCAAGCTACGAGGAGCCCGCCTATACCGAGGATTCCTCTTACCAGACGCCCACGTACGAGGAGCCC
GCCTACACCGAGGAGCCAAGCTACGAGCAGCCGGCCTACACCGAGGATTCCTCTTACCAGACGCCCACATATGAG
GAGCCTGCTTATACCGAAGAGCCTAGCTACGAGCAGCCGGCCTACACCGAGGAGCCTTCATACCAGACCCCTACG
TATGAGGAGCCTGCTTACACCGAGGAGCCTAGCTACGACACGCCTACGTACGAGCAGCCGGCTTACAACGGCCAG
GAGCCCTCGTACCAGACCCCCACGTACGAGGAGCCTTCTTATGAGACGCCTACCTACGAAGCGCCCGTCTACACC
GAGGTTCCCGCCGACCAGGTCTACGAGAACACTTGGGAGGGCCCGCCATTCACGGACCCGGACTACACGACTACG
TACGTCCAGTACACGCCGACGCCCACCAACGAGCCGGCCTACACCGAGACACCGTCTTACGAGGAGCCGGCTTAC
ACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACA
CCGTCTTACGAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACACCGTCCTAC
GAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGACGTACGAGCAGCCTACGTACAACGAGCCTTCC
TACCAGCAGCCGGCCTATGAGGAGCCTGCTTACACCGAGACGCCGACCTACGAGGAGCCCGCTTACACCGAGACT
CCGGATCCCACGTACTCTCCAGGATATGACGAGCCCAGCTACGAGCCGGAGCAGCCTGATTACACCGAGGAGCCG
GAGCAACCTGCCTACACCGAGGAGCCTGGCTATGGCTCGCCGTCTTACTCTGGGTCGTCTGGTGGATCAGGTTAC
GATGATCCTATCTACCAGGAGCCCTCCTACGAGCAGCCGACTTACACTGGCTACGACGAGCCTTCTTACTCTTCT
GCTCCGACTTACGATCAGCCCAGCTACCCCCAGGAGCCCAGCTACCCCGAGCAGCCCTCGTATGAGCCGGAACAG
CCTGGCTACCCGCAGGAGCCCAGCTACCAGCCCGAGGAGCCGGCCTACACGGAGCAGCCCTCTTACGAGCCTGAG
CAGCCTGGCTACCCGCAAGAGCCCAGCTACCAGCCCGAGGAGCCGGCTTACACGGAGCAGCCTTCATACGAGCCT
GAGCAGCCCAGCTACCCCCAGGAACCCAGCTACGAGCCGGAGCAGCCCTCGTACGAGCCCCAGCAGCCTGGTTAC
CCCCAGGAGCCGAGCTACGAGCCCGAGCAGCCCTCGTATGAGCCGGAACAGCCTGGCTACCCGCAGGAGCCCAAC
TACCCCGAGCAGCCCTCTTATGAGCCTGAGCAGCCGTCTTACCCCCAGGAGCCTTCCTACGAGCCGGAACAGCCC
TCCTACGAGCCTGAGCAGCCTGGATACCCCCAGGAGCCGAGCTACGAGCCTGAGCAGCCCTCCCCAGCTACCCCC
AGGAGCCGAGCTATGAGCCTGAGCAGCCCTCCCCAGCTACCCCCAGGAGCCGAGCTACGAGCCTGA
Gene >Ophun1|4155
ATGCACTTCTTAATCGCCCCCTTGATTTTGGGCGCCGCTGCTACGGCAGCCGAGCACCATAATGCTCGGGAGTCG
GGCTCCGTCGTGCCCGTCGCCGAGATGCGCAGGGATATGGCTGCCGTGGCTGAGAAGGGTGAGGCTCGTGAGGAG
ACGCCCTTGATGATGAACTCGGCCAAGTTCCGCAACAACAAGAGGCAGGATGGCTATGGCTCGGGGAGCGGTGAC
GGCTATGGTGGCAGCGGTGACGGCTACGGGGGGAACGCCGGTGGTGACGCCGGTGGTAACGCCGGTGGCAACGCC
GGTGGCAACTCGGCCAACGGCGGATACGGAGGAAACACCGGCTACGGAGACAACTCGGCCAACGGCGGCAACGGA
GCCGACAACGGCTATGGCGATGTCCCCACCTACGAGACTCCCTCCGACGCCGACACCGACCAGTCCTTCGCGTAC
AGCGCCTCCGACAACAGCCCGAGCTACGGCAACGGAGGCTCCAACCCCCCGAGCTATGGCAACGACGGCGCCGGC
AACCCGAACTACGGCAACGACGGCTCCAACCCCCTCGCTCCCGGAACGCCCATCGATCTCATGTACAACATGCTG
AACGAGCCTCCGTACGTTACCAACGACGGAAAGCCTACCTACGCCGAAAACATGGGTTCCAATGAGGATTACGGC
ACGCCGTCGTACGGGTCGTCTTCTGATGAGCAGCCGGCTTACACCGAGGACTCTTCTTACCAGACGCCTACGTAT
GAGCAGCCGGCCTACACTGAGGACTCCTCCTACCAGACGCCTACGTACGAGCAGCCGGCCTACACCGAGGAGCCG
ACCTACGAGGAGCCGGCTTACACCGAGGACCCTGCCTACGGGTCTCCTTCTTACGAGCAGCCTGAGCAGCCTGCC
TACCAGGATACGTCTTACGAGCAGCCGGCCTACACCGAGGAGCCGACCTACGAGCAGCCCGCTTACACCGAGGAC
TCTTCTTACCAGACGCCTACGTACGAGCAGCCGTCTTACACCGAGGAGCCTACGTACGAGCAGCCAGCCTACACC
GAGGAGCCGACCTACGAGGAGCCGGCTTACACCGAGGACCCTGCCTACGGGTCTCCTTCTTACGAGCAGCCTGAG
CAGCCTGCCTACCAGGATTCGTCTTACGAGCAGCCTGCCTACACCGAGGATTCTTCTTACCAGACGCCTACGTAC
GAGGAGCCTGCTTATACCGAAGAGCCTGCCTACGACACGCCTACGTACGAGCAGCCGGCTTACAACGGCCAGGAG
CCTTCCTACCAGACGCCCACGTACGAGGAGCCCGCCTACACCGAGGAGCCAAGCTACGAGCAGCCGGCCTACACC
GAGGAGCCTTCATACCAGACCCCTACGTATGAGGAGCCTGCTTATACCGAGGAGCCTGCCTACGACACGCCTACG
TATGAGCAGCCAGCTTACAACGGCCAGGAGCCTTCCTACCAGACGCCCACGTACGAGGAGCCTGCCTACACCGAG
GAGCCAAGCTACGAGCAGCCGGCCTACACCGAGGAGCCTTCATACCAGACGCCTACGTACGAGGAGCCTGCCTAC
ACCGAGGAGCCAAGCTACGAGGAGCCCGCCTATACCGAGGATTCCTCTTACCAGACGCCCACGTACGAGGAGCCC
GCCTACACCGAGGAGCCAAGCTACGAGCAGCCGGCCTACACCGAGGATTCCTCTTACCAGACGCCCACATATGAG
GAGCCTGCTTATACCGAAGAGCCTAGCTACGAGCAGCCGGCCTACACCGAGGAGCCTTCATACCAGACCCCTACG
TATGAGGAGCCTGCTTACACCGAGGAGCCTAGCTACGACACGCCTACGTACGAGCAGCCGGCTTACAACGGCCAG
GAGCCCTCGTACCAGACCCCCACGTACGAGGAGCCTTCTTATGAGACGCCTACCTACGAAGCGCCCGTCTACACC
GAGGTTCCCGCCGACCAGGTCTACGAGAACACTTGGGAGGGCCCGCCATTCACGGACCCGGACTACACGACTACG
TACGTCCAGTACACGCCGACGCCCACCAACGAGCCGGCCTACACCGAGACACCGTCTTACGAGGAGCCGGCTTAC
ACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACA
CCGTCTTACGAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGGCCTACACCGAGACACCGTCCTAC
GAGGAGCCGGCCTACACCGAGACGCCGTCCTACGAGGAGCCGACGTACGAGCAGCCTACGTACAACGAGCCTTCC
TACCAGCAGCCGGCCTATGAGGAGCCTGCTTACACCGAGACGCCGACCTACGAGGAGCCCGCTTACACCGAGACT
CCGGATCCCACGTACTCTCCAGGATATGACGAGCCCAGCTACGAGCCGGAGCAGCCTGATTACACCGAGGAGCCG
GAGCAACCTGCCTACACCGAGGAGCCTGGCTATGGCTCGCCGTCTTACTCTGGGTCGTCTGGTGGATCAGGTTAC
GATGATCCTATCTACCAGGAGCCCTCCTACGAGCAGCCGACTTACACTGGCTACGACGAGCCTTCTTACTCTTCT
GCTCCGACTTACGATCAGCCCAGCTACCCCCAGGAGCCCAGCTACCCCGAGCAGCCCTCGTATGAGCCGGAACAG
CCTGGCTACCCGCAGGAGCCCAGCTACCAGCCCGAGGAGCCGGCCTACACGGAGCAGCCCTCTTACGAGCCTGAG
CAGCCTGGCTACCCGCAAGAGCCCAGCTACCAGCCCGAGGAGCCGGCTTACACGGAGCAGCCTTCATACGAGCCT
GAGCAGCCCAGCTACCCCCAGGAACCCAGCTACGAGCCGGAGCAGCCCTCGTACGAGCCCCAGCAGCCTGGTTAC
CCCCAGGAGCCGAGCTACGAGCCCGAGCAGCCCTCGTATGAGCCGGAACAGCCTGGCTACCCGCAGGAGCCCAAC
TACCCCGAGCAGCCCTCTTATGAGCCTGAGCAGCCGTCTTACCCCCAGGAGCCTTCCTACGAGCCGGAACAGCCC
TCCTACGAGCCTGAGCAGCCTGGATACCCCCAGGAGCCGAGCTACGAGCCTGAGCAGCCCTCGTACGAGCCGGAA
CAACCCAGCTATCCCCAGGAACCGAACTACGAGCCTGAGCAGCCCAGCTACCCCCAGGAGCCGAGCTATGAGCCT
GAGCAGCCCTCGTATGAGCCCGAGCAGCCCGGCTACCCCCAGGAACCGAGCTACGAGCCCGAGCAACCTTCCTAC
GAGCCGGAACAGCCCAGCTACCCCCAGGAGCCGAGCTACGAGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail