Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4152
Gene name
LocationContig_38:49471..50530
Strand-
Gene length (bp)1059
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06391 MAT1 CDK-activating kinase assembly factor MAT1 3.3E-29 75 238
PF17121 zf-C3HC4_5 Zinc finger, C3HC4 type (RING finger) 4.0E-28 22 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 23 336 2.0E-54
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 20 334 1.0E-51
sp|Q75D20|TFB3_ASHGO RNA polymerase II transcription factor B subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB3 PE=3 SV=1 20 334 1.0E-50
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 20 334 2.0E-49
sp|Q6C7D0|TFB3_YARLI RNA polymerase II transcription factor B subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB3 PE=3 SV=1 20 334 3.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BP96|TFB3_DEBHA RNA polymerase II transcription factor B subunit 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB3 PE=3 SV=2 23 336 2.0E-54
sp|Q6CT73|TFB3_KLULA RNA polymerase II transcription factor B subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB3 PE=3 SV=1 20 334 1.0E-51
sp|Q75D20|TFB3_ASHGO RNA polymerase II transcription factor B subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB3 PE=3 SV=1 20 334 1.0E-50
sp|Q03290|TFB3_YEAST RNA polymerase II transcription factor B subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB3 PE=1 SV=1 20 334 2.0E-49
sp|Q6C7D0|TFB3_YARLI RNA polymerase II transcription factor B subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB3 PE=3 SV=1 20 334 3.0E-48
sp|Q6FMP4|TFB3_CANGA RNA polymerase II transcription factor B subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB3 PE=3 SV=1 16 334 2.0E-46
sp|O94684|TFB3_SCHPO RNA polymerase II transcription factor B subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmh1 PE=1 SV=1 22 327 2.0E-43
sp|P51949|MAT1_MOUSE CDK-activating kinase assembly factor MAT1 OS=Mus musculus GN=Mnat1 PE=1 SV=2 21 327 7.0E-27
sp|P51948|MAT1_HUMAN CDK-activating kinase assembly factor MAT1 OS=Homo sapiens GN=MNAT1 PE=1 SV=1 21 327 1.0E-25
sp|P51950|MAT1_MARGL CDK-activating kinase assembly factor MAT1 OS=Marthasterias glacialis PE=1 SV=1 21 336 7.0E-24
sp|P51951|MAT1_XENLA CDK-activating kinase assembly factor MAT1 OS=Xenopus laevis GN=mnat1 PE=2 SV=1 21 327 5.0E-23
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3876
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4584
Ophiocordyceps australis map64 (Brazil) OphauB2|351
Ophiocordyceps camponoti-floridani Ophcf2|02588
Ophiocordyceps camponoti-rufipedis Ophun1|4152 (this protein)
Ophiocordyceps kimflemingae Ophio5|8055
Ophiocordyceps subramaniannii Hirsu2|7691

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4152
MSRGSLTSVRNGVPSSQAPDDDETCPVCKTTRYFNRDMEFRINPECYHRMCKTCVERIFKDGPNQCPYAGCHKTL
RLRGFKAAFFADLGVEREVDIRRRVAAVFNKVEDDFEHLDGYNDYLYMVECLTDDLVSGPPEARAKAETQLTDWE
AKHRAEIERNRRLARESDEARARRIAAENDAARQRRLQDLREAADEKATAARFREEMLDSLQSADVGHAAQAVDK
VLLKKRGQQRRQAVASAAASAASGLSIRGLRDKTKAVVDEGPYDPFAGLHLAPDRVELGPDRLRDYHSEWIDVIR
SKNDYLVGGYSADEYISRALFEAFSGLGVFIADEKSDNKPLPSATKMEMDRS*
Coding >Ophun1|4152
ATGTCCCGTGGAAGCCTGACCTCAGTCCGAAACGGCGTCCCATCATCCCAAGCCCCCGACGATGACGAAACATGT
CCCGTCTGCAAGACAACACGCTACTTCAACAGAGACATGGAATTCCGCATCAACCCAGAATGCTACCACCGCATG
TGCAAGACGTGCGTCGAGCGCATCTTCAAGGATGGACCTAATCAGTGCCCCTACGCAGGATGCCACAAGACGCTC
CGTCTCCGTGGCTTCAAGGCCGCCTTCTTCGCTGACCTCGGCGTCGAGCGCGAAGTCGACATCCGGCGTCGCGTC
GCCGCCGTCTTCAACAAAGTAGAAGACGACTTTGAACATCTGGACGGCTATAACGATTATCTATACATGGTCGAG
TGTCTAACTGATGACCTCGTCTCCGGCCCCCCAGAAGCAAGAGCAAAAGCCGAGACGCAATTAACCGACTGGGAA
GCCAAGCACCGCGCCGAAATCGAGCGAAACAGACGTCTAGCCCGCGAATCAGACGAGGCGCGAGCCCGCCGCATC
GCCGCCGAAAACGACGCCGCCCGCCAACGCCGCCTCCAAGACCTCCGCGAAGCAGCCGACGAAAAGGCCACGGCC
GCCCGCTTCCGCGAGGAGATGCTGGACTCCCTGCAGAGCGCCGACGTCGGTCACGCCGCCCAGGCCGTCGACAAG
GTCCTCCTCAAGAAGCGCGGACAGCAGCGTCGCCAGGCTGTTGCCAGCGCCGCCGCCTCCGCCGCCTCGGGCTTG
TCTATTCGCGGTCTGCGCGATAAGACCAAGGCTGTTGTTGATGAGGGGCCTTATGATCCCTTTGCTGGCTTGCAT
CTTGCGCCGGATCGTGTCGAGCTCGGGCCTGATCGCCTGCGCGATTACCACAGCGAGTGGATCGACGTCATTCGC
TCCAAGAATGATTATCTCGTCGGGGGATACAGCGCCGACGAGTACATTTCCCGAGCTCTGTTCGAAGCCTTTTCC
GGTCTGGGCGTCTTCATCGCCGATGAGAAATCCGATAACAAGCCTTTACCGTCTGCTACCAAGATGGAAATGGAC
CGGTCTTGA
Transcript >Ophun1|4152
ATGTCCCGTGGAAGCCTGACCTCAGTCCGAAACGGCGTCCCATCATCCCAAGCCCCCGACGATGACGAAACATGT
CCCGTCTGCAAGACAACACGCTACTTCAACAGAGACATGGAATTCCGCATCAACCCAGAATGCTACCACCGCATG
TGCAAGACGTGCGTCGAGCGCATCTTCAAGGATGGACCTAATCAGTGCCCCTACGCAGGATGCCACAAGACGCTC
CGTCTCCGTGGCTTCAAGGCCGCCTTCTTCGCTGACCTCGGCGTCGAGCGCGAAGTCGACATCCGGCGTCGCGTC
GCCGCCGTCTTCAACAAAGTAGAAGACGACTTTGAACATCTGGACGGCTATAACGATTATCTATACATGGTCGAG
TGTCTAACTGATGACCTCGTCTCCGGCCCCCCAGAAGCAAGAGCAAAAGCCGAGACGCAATTAACCGACTGGGAA
GCCAAGCACCGCGCCGAAATCGAGCGAAACAGACGTCTAGCCCGCGAATCAGACGAGGCGCGAGCCCGCCGCATC
GCCGCCGAAAACGACGCCGCCCGCCAACGCCGCCTCCAAGACCTCCGCGAAGCAGCCGACGAAAAGGCCACGGCC
GCCCGCTTCCGCGAGGAGATGCTGGACTCCCTGCAGAGCGCCGACGTCGGTCACGCCGCCCAGGCCGTCGACAAG
GTCCTCCTCAAGAAGCGCGGACAGCAGCGTCGCCAGGCTGTTGCCAGCGCCGCCGCCTCCGCCGCCTCGGGCTTG
TCTATTCGCGGTCTGCGCGATAAGACCAAGGCTGTTGTTGATGAGGGGCCTTATGATCCCTTTGCTGGCTTGCAT
CTTGCGCCGGATCGTGTCGAGCTCGGGCCTGATCGCCTGCGCGATTACCACAGCGAGTGGATCGACGTCATTCGC
TCCAAGAATGATTATCTCGTCGGGGGATACAGCGCCGACGAGTACATTTCCCGAGCTCTGTTCGAAGCCTTTTCC
GGTCTGGGCGTCTTCATCGCCGATGAGAAATCCGATAACAAGCCTTTACCGTCTGCTACCAAGATGGAAATGGAC
CGGTCTTGA
Gene >Ophun1|4152
ATGTCCCGTGGAAGCCTGACCTCAGTCCGAAACGGCGTCCCATCATCCCAAGCCCCCGACGATGACGAAACATGT
CCCGTCTGCAAGACAACACGCTACTTCAACAGAGACATGGAATTCCGCATCAACCCAGAATGCTACCACCGCATG
TGCAAGACGTGCGTCGAGCGCATCTTCAAGGATGGACCTAATCAGTGCCCCTACGCAGGATGCCACAAGACGCTC
CGTCTCCGTGGCTTCAAGGCCGCCTTCTTCGCTGACCTCGGCGTCGAGCGCGAAGTCGACATCCGGCGTCGCGTC
GCCGCCGTCTTCAACAAAGTAGAAGACGACTTTGAACATCTGGACGGCTATAACGATTATCTATACATGGTCGAG
TGTCTAACTGATGACCTCGTCTCCGGCCCCCCAGAAGCAAGAGCAAAAGCCGAGACGCAATTAACCGACTGGGAA
GCCAAGCACCGCGCCGAAATCGAGCGAAACAGACGTCTAGCCCGCGAATCAGACGAGGCGCGAGCCCGCCGCATC
GCCGCCGAAAACGACGCCGCCCGCCAACGCCGCCTCCAAGACCTCCGCGAAGCAGCCGACGAAAAGGCCACGGCC
GCCCGCTTCCGCGAGGAGATGCTGGACTCCCTGCAGAGCGCCGACGTCGGTCACGCCGCCCAGGCCGTCGACAAG
GTCCTCCTCAAGAAGCGCGGACAGCAGCGTCGCCAGGCTGTTGCCAGCGCCGCCGCCTCCGCCGCCTCGGGCTTG
TCTATTCGCGGTCTGCGCGATAAGACCAAGGCTGTTGTTGATGAGGGGCCTTATGATCCCTTTGCTGGCTTGCAT
CTTGCGCCGGATCGTGTCGAGCTCGGGCCTGATCGCCTGCGCGATTACCACAGCGAGTGGATCGACGTCATTCGC
TCCAAGAATGATTATCTCGTCGGGGGATACAGCGCCGACGAGTACATTTCCCGAGCTCTGTTCGAAGCCTTTTCC
GGTCTGGGCGTCTTCATCGCCGATGAGAAATCCGATAACAAGCCTTTACCGTCTGCTACCAAGATGGAAATGGAC
CGGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail