Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4148
Gene name
LocationContig_38:38576..38951
Strand+
Gene length (bp)375
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 1.6E-08 24 66
PF01476 LysM LysM domain 5.2E-11 77 123

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34669|YOCH_BACSU Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) GN=yocH PE=1 SV=1 17 99 1.0E-07
sp|P39046|MUR2_ENTHA Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=EHR_05900 PE=1 SV=1 15 123 3.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999608

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup229
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4895
Ophiocordyceps camponoti-floridani Ophcf2|01392
Ophiocordyceps camponoti-floridani Ophcf2|02584
Ophiocordyceps camponoti-floridani Ophcf2|03908
Ophiocordyceps camponoti-rufipedis Ophun1|4148 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6485
Ophiocordyceps kimflemingae Ophio5|2669
Ophiocordyceps kimflemingae Ophio5|5651
Ophiocordyceps kimflemingae Ophio5|5719
Ophiocordyceps subramaniannii Hirsu2|3699
Ophiocordyceps subramaniannii Hirsu2|6751

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4148
MALLRLMLIAGALCSAASACAETYTVSFGDTCWGVSVNKSVSMKNIEAWNTKLDCARLRPGDEMCVSQRNVPCRY
HHHVVKGDSCWKIADEQGTTIQHLFDLNPNLINSPSDCPLFPGQKVCVV*
Coding >Ophun1|4148
ATGGCCCTCCTCCGACTCATGCTCATCGCCGGAGCTCTCTGCTCTGCCGCCTCGGCCTGCGCAGAGACGTACACC
GTCAGCTTTGGCGACACCTGCTGGGGAGTCTCGGTGAACAAGTCCGTCTCCATGAAGAACATCGAGGCTTGGAAC
ACGAAGCTCGACTGCGCCCGTCTTCGTCCCGGAGATGAGATGTGCGTCTCTCAGCGCAACGTTCCCTGCAGATAC
CACCACCATGTCGTCAAAGGCGACTCCTGCTGGAAGATCGCCGACGAACAGGGGACCACGATTCAGCATTTGTTC
GATCTCAACCCCAACCTGATCAACAGCCCGTCCGACTGCCCCCTGTTCCCGGGCCAGAAGGTCTGTGTGGTCTAG
Transcript >Ophun1|4148
ATGGCCCTCCTCCGACTCATGCTCATCGCCGGAGCTCTCTGCTCTGCCGCCTCGGCCTGCGCAGAGACGTACACC
GTCAGCTTTGGCGACACCTGCTGGGGAGTCTCGGTGAACAAGTCCGTCTCCATGAAGAACATCGAGGCTTGGAAC
ACGAAGCTCGACTGCGCCCGTCTTCGTCCCGGAGATGAGATGTGCGTCTCTCAGCGCAACGTTCCCTGCAGATAC
CACCACCATGTCGTCAAAGGCGACTCCTGCTGGAAGATCGCCGACGAACAGGGGACCACGATTCAGCATTTGTTC
GATCTCAACCCCAACCTGATCAACAGCCCGTCCGACTGCCCCCTGTTCCCGGGCCAGAAGGTCTGTGTGGTCTAG
Gene >Ophun1|4148
ATGGCCCTCCTCCGACTCATGCTCATCGCCGGAGCTCTCTGCTCTGCCGCCTCGGCCTGCGCAGAGACGTACACC
GTCAGCTTTGGCGACACCTGCTGGGGAGTCTCGGTGAACAAGTCCGTCTCCATGAAGAACATCGAGGCTTGGAAC
ACGAAGCTCGACTGCGCCCGTCTTCGTCCCGGAGATGAGATGTGCGTCTCTCAGCGCAACGTTCCCTGCAGATAC
CACCACCATGTCGTCAAAGGCGACTCCTGCTGGAAGATCGCCGACGAACAGGGGACCACGATTCAGCATTTGTTC
GATCTCAACCCCAACCTGATCAACAGCCCGTCCGACTGCCCCCTGTTCCCGGGCCAGAAGGTCTGTGTGGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail