Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4143
Gene name
LocationContig_38:29761..31553
Strand+
Gene length (bp)1792
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08583 Cmc1 Cytochrome c oxidase biogenesis protein Cmc1 like 4.1E-17 279 346

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRU5|COXM2_SCHPO COX assembly mitochondrial protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmc2 PE=1 SV=1 275 341 2.0E-08
sp|Q552P9|Y5933_DICDI Uncharacterized protein DDB_G0275933 OS=Dictyostelium discoideum GN=DDB_G0275933 PE=3 SV=1 264 362 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 49 66 17
3 79 101 22
4 121 143 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4143
MEQTKADRDVLRTPTWVLGIRIAQSVLSLLILALSAAIATRNYIDESGLSLAVSLMTWLSIAYMTLTERLPTLRT
GYHVVAVLALDGLLIVLWLAAFAALAARRAMWYAYTGIEGLTSATAGLGSLEWILFIITFVWGLVSFLKGRKQGR
FPLNLPKTEECAMETTEAAAAPTQMPVPTSTPSPQPTPSPYSPPLLTPQSPYMADALPHGTVVAYGSPGPAYGSQ
QQQQQQVYSETRGTIKSITPDRKAASGSPDDGGQRPHLVATSPLPLSASQEAQVRELYRSRVRQKCADEIKAFAA
CATGRTFSVVFACREQHRAMNSCMNSYATRQEEDAAREEWFALRLQRTRRREHEARVAAAQEEFMHDWWGLPEDV
RLSKKGRQQQADKTGRDRGDGTGS*
Coding >Ophun1|4143
ATGGAGCAAACGAAAGCGGATCGTGATGTTCTCCGAACCCCGACTTGGGTACTGGGCATCCGCATCGCCCAGTCG
GTTCTATCTCTACTCATCCTAGCGCTCTCGGCGGCGATAGCGACGCGAAACTACATCGACGAGTCCGGTCTTTCC
TTGGCTGTGTCGCTTATGACGTGGCTTTCGATAGCGTATATGACGCTCACAGAGCGGTTGCCGACTCTTCGCACG
GGCTATCACGTCGTCGCGGTGCTGGCTCTCGATGGGCTCCTCATCGTGCTGTGGCTCGCTGCCTTTGCGGCACTG
GCGGCGCGGAGGGCCATGTGGTATGCTTACACGGGCATCGAGGGTTTGACGTCGGCCACGGCTGGTCTCGGGTCT
CTGGAGTGGATCTTGTTCATCATCACTTTCGTCTGGGGCCTCGTCAGCTTCTTAAAGGGCCGGAAGCAGGGCCGC
TTCCCACTCAACCTCCCCAAGACGGAAGAGTGCGCCATGGAGACGACCGAGGCGGCAGCGGCGCCGACGCAGATG
CCGGTGCCGACTTCGACGCCGAGTCCGCAGCCGACGCCGAGCCCATATTCGCCTCCGCTTCTGACGCCGCAGTCG
CCGTACATGGCCGATGCTCTTCCTCACGGCACCGTCGTCGCCTATGGGTCGCCCGGACCGGCTTACGGCTCACAG
CAGCAGCAACAGCAACAGGTGTATTCAGAGACTCGGGGTACCATAAAGTCCATCACCCCAGATAGGAAGGCGGCG
TCGGGCTCACCAGATGATGGCGGCCAGCGTCCTCACCTCGTAGCAACAAGCCCGCTACCGCTCTCAGCCTCACAG
GAAGCCCAGGTGCGCGAGTTATACCGGTCGCGCGTACGGCAAAAATGCGCCGACGAGATCAAAGCCTTCGCCGCG
TGCGCCACCGGGCGGACCTTTTCCGTCGTCTTCGCCTGCCGCGAGCAGCACCGGGCCATGAACAGCTGCATGAAC
AGCTACGCGACGCGGCAGGAGGAGGACGCGGCTCGTGAGGAGTGGTTCGCTTTGCGGCTGCAGCGGACGAGGCGG
CGGGAGCACGAGGCTCGCGTCGCGGCTGCGCAGGAGGAATTCATGCATGACTGGTGGGGGCTGCCGGAAGACGTG
AGGCTCTCCAAGAAAGGGCGGCAGCAGCAGGCGGATAAGACGGGCAGGGACCGAGGCGACGGGACGGGGAGCTGA
Transcript >Ophun1|4143
ATGGAGCAAACGAAAGCGGATCGTGATGTTCTCCGAACCCCGACTTGGGTACTGGGCATCCGCATCGCCCAGTCG
GTTCTATCTCTACTCATCCTAGCGCTCTCGGCGGCGATAGCGACGCGAAACTACATCGACGAGTCCGGTCTTTCC
TTGGCTGTGTCGCTTATGACGTGGCTTTCGATAGCGTATATGACGCTCACAGAGCGGTTGCCGACTCTTCGCACG
GGCTATCACGTCGTCGCGGTGCTGGCTCTCGATGGGCTCCTCATCGTGCTGTGGCTCGCTGCCTTTGCGGCACTG
GCGGCGCGGAGGGCCATGTGGTATGCTTACACGGGCATCGAGGGTTTGACGTCGGCCACGGCTGGTCTCGGGTCT
CTGGAGTGGATCTTGTTCATCATCACTTTCGTCTGGGGCCTCGTCAGCTTCTTAAAGGGCCGGAAGCAGGGCCGC
TTCCCACTCAACCTCCCCAAGACGGAAGAGTGCGCCATGGAGACGACCGAGGCGGCAGCGGCGCCGACGCAGATG
CCGGTGCCGACTTCGACGCCGAGTCCGCAGCCGACGCCGAGCCCATATTCGCCTCCGCTTCTGACGCCGCAGTCG
CCGTACATGGCCGATGCTCTTCCTCACGGCACCGTCGTCGCCTATGGGTCGCCCGGACCGGCTTACGGCTCACAG
CAGCAGCAACAGCAACAGGTGTATTCAGAGACTCGGGGTACCATAAAGTCCATCACCCCAGATAGGAAGGCGGCG
TCGGGCTCACCAGATGATGGCGGCCAGCGTCCTCACCTCGTAGCAACAAGCCCGCTACCGCTCTCAGCCTCACAG
GAAGCCCAGGTGCGCGAGTTATACCGGTCGCGCGTACGGCAAAAATGCGCCGACGAGATCAAAGCCTTCGCCGCG
TGCGCCACCGGGCGGACCTTTTCCGTCGTCTTCGCCTGCCGCGAGCAGCACCGGGCCATGAACAGCTGCATGAAC
AGCTACGCGACGCGGCAGGAGGAGGACGCGGCTCGTGAGGAGTGGTTCGCTTTGCGGCTGCAGCGGACGAGGCGG
CGGGAGCACGAGGCTCGCGTCGCGGCTGCGCAGGAGGAATTCATGCATGACTGGTGGGGGCTGCCGGAAGACGTG
AGGCTCTCCAAGAAAGGGCGGCAGCAGCAGGCGGATAAGACGGGCAGGGACCGAGGCGACGGGACGGGGAGCTGA
Gene >Ophun1|4143
ATGGAGCAAACGAAAGCGGATCGTGATGTTCTCCGAACCCCGACTTGGGTACTGGGCATCCGCATCGCCCAGTCG
GTTCTATCTCTACTCATCCTAGCGCTCTCGGCGGCGATAGCGACGCGAAACTACATCGACGAGTCCGGTCTTTCC
TTGGCTGTGGTGCGTCTTGTCATCGTCTTGACTCTCCTCTTCAATGGAGGAAGGGCAAGGCTCGCCGTGAGGAAA
CATGGAGAATTGCACTGACGTTGTTTATTCAGTCGCTTATGACGTGGCTTTCGATAGCGTATATGACGCTCACAG
AGCGGTTGCCGACTCTTCGCACGGGCTATCACGTCGTCGCGGTGCTGGCTCTCGATGGGCTCCTCATCGTGCTGT
GGCTCGCTGCCTTTGCGGCACTGGCGGCGCGGAGGGCCATGTGGTATGCTTACACGGGCATCGAGGGTTTGACGT
CGGCCACGGCTGGTCTCGGGTCTCTGGAGTGGTGAGTAGGAAGGGTTCGTGATTGAAACTCGGGCTCAAAGAAAC
TGACCTCTACGCTCAAGGATCTTGTTCATCATCACTTTCGTCTGGGGCCTCGTCAGCTTCTTAAAGGGCCGGAAG
CAGGGCCGCTTCCCACTCAACCTCCCCAAGACGGAAGAGTGCGCCATGGAGACGACCGAGGCGGCAGCGGCGCCG
ACGCAGATGCCGGTGCCGACTTCGACGCCGAGTCCGCAGCCGACGCCGAGCCCATATTCGCCTCCGCTTCTGACG
CCGCAGTCGCCGTACATGGCCGATGCTCTTCCTCACGGCACCGTCGTCGCCTATGGGTCGCCCGGACCGGCTTAC
GGCTCACAGCAGCAGCAACAGCAACAGGTGTATTCAGAGACTCGGGGTAGTGAGCTTCCTGCGCAGGAGCTGCCG
CATAGTGCGCCCTCTCTCGTTGCTGGTTCGCCGGCGCATCCTAAAGCGTCTTGAGGGCTGTAGACGGCGATGAGG
GACGGGGTGAATGATCCGATAGAGGCTTAGGGGTTGGAGCATGTATGTTATGATTCGCGGAGGATGACTGAAGAG
AATTCAAAGCGAATGTGAATCCAGAAATGAATGTTACTGGCCGTCTTCATGTCTCGAGTCCCTTAACCCTAACCC
TAAGCAGCCATAAAGTCCATCACCCCAGATAGGAAGGCGGTCTGACGAAACGCCCATCGTCATCACCAGCTTTCT
TCGCCTCGCCGCCTCCAGCTCCCATCACCCTCACATCCTCGCCACAGCCAGACACGGCCCAAATTCCTGACGGAT
GGCGGCCCAGGCGTCGGGCTCACCAGATGATGGCGGCCAGCGTCCTCACCTCGTAGCAACAAGCCCGCTACCGCT
CTCAGCCTCACAGGAAGCCCAGGTGCGCGAGTTATACCGGTCGCGCGTACGGCAAAAATGCGCCGACGAGATCAA
AGGTCCGTCTCAGCCTTCTCGGAACGCAGACTGCAGTCGCTGACAGACCAGGGCAGCCTTCGCCGCGTGCGCCAC
CGGGCGGACCTTTTCCGTCGTCTTCGCCTGCCGCGAGCAGCACCGGGCCATGAACAGCTGCATGAACAGCTACGC
GACGCGGCAGGAGGAGGACGCGGCTCGTGAGGAGTGGTTCGCTTTGCGGCTGCAGCGGACGAGGCGGCGGGAGCA
CGAGGCTCGCGTCGCGGCTGCGCAGGAGGAATTCATGCATGACTGGTGGGGGCTGCCGGAAGACGTGAGGCTCTC
CAAGAAAGGGCGGCAGCAGCAGGCGGATAAGACGGGCAGGGACCGAGGCGACGGGACGGGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail